357952-10-4 Usage
General Description
The chemical "FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2" is a peptide consisting of 37 amino acids, including phenylalanine (F), threonine (T), leucine (L), serine (S), aspartic acid (D), valine (V), proline (P), isoleucine (I), methionine (M), asparagine (N), alanine (A), lysine (K), and glutamine (Q). The peptide terminates with an amidated (NH2) group. This sequence may have potential biological activity, such as binding to receptors, enzymes, or other proteins in the body, and could be involved in various physiological processes or pathological conditions. Further research is needed to determine the exact function and effects of this peptide in biological systems.
Check Digit Verification of cas no
The CAS Registry Mumber 357952-10-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 3,5,7,9,5 and 2 respectively; the second part has 2 digits, 1 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 357952-10:
(8*3)+(7*5)+(6*7)+(5*9)+(4*5)+(3*2)+(2*1)+(1*0)=174
174 % 10 = 4
So 357952-10-4 is a valid CAS Registry Number.