106686-61-7

Basic information

• Product Name: (GLN11)-AMYLOID BETA-PROTEIN (1-28)
• Synonyms: BETA-AMYLOID PEPTIDE (1-40, GLN11), HUMAN;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLN-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-OH;(GLN11)-AMYLOID BETA-PROTEIN (1-28);[GLN11]-BETA-AMYLOID (1-28);[GLN11]-BETA-AMYLOID (1-40);DAEFRHDSGYQVHHQKLVFFAEDVGSNK;DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;(gln11)-amyloid B-protein fragment 1-28
• CAS NO: 106686-61-7
• Molecular Formula: C145H210N42O45
• Molecular Weight: 3261.47
• Product Categories: peptide
• Mol File: 106686-61-7.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Density: 1.52±0.1 g/cm3(Predicted)
• Storage Temp.: -15°C
• Water Solubility: Soluble in water at 1mg/ml
• CAS DataBase Reference: (GLN11)-AMYLOID BETA-PROTEIN (1-28)(CAS DataBase Reference)
• NIST Chemistry Reference: (GLN11)-AMYLOID BETA-PROTEIN (1-28)(106686-61-7)
• EPA Substance Registry System: (GLN11)-AMYLOID BETA-PROTEIN (1-28)(106686-61-7)

Safety Data

• Hazardous Substances Data: 106686-61-7(Hazardous Substances Data)

Usage

Description

(GLN11)-AMYLOID BETA-PROTEIN (1-28), also known as Aβ(1-28), is a peptide fragment derived from the amyloid-beta protein. It consists of 28 amino acids and has a single substitution of glutamine at the 11th position. This modification may alter the properties and functions of the peptide compared to the wild-type amyloid-beta protein. Aβ(1-28) is involved in various biological processes and is a subject of interest in the context of Alzheimer's disease and neurodegenerative disorders.

Uses

Used in Pharmaceutical and Biomedical Research:
(GLN11)-AMYLOID BETA-PROTEIN (1-28) is used as a research tool for studying the metabolic and regulatory functions of amyloid-beta peptides. It helps in understanding the activation of kinases, regulation of cholesterol transport, transcription factor activity, and the role of Aβ peptides as regulators of inflammation.
Used in Alzheimer's Disease Research:
In the field of Alzheimer's disease research, (GLN11)-AMYLOID BETA-PROTEIN (1-28) is used as a model to investigate the mechanisms of oxidative stress, metal binding, and protein cross-linking. These processes are crucial for understanding the pathogenesis of Alzheimer's disease and the development of potential therapeutic strategies.
Used in Neurodegenerative Disease Research:
(GLN11)-AMYLOID BETA-PROTEIN (1-28) is also employed in the study of other neurodegenerative diseases, where amyloid-beta peptides and their fragments may play a role in the disease progression. This research can provide insights into the molecular mechanisms underlying these disorders and contribute to the development of novel therapeutic approaches.