123139-39-9

Basic information

• Product Name: NEUROPEPTIDE Y (2-36) (HUMAN, RAT)
• Synonyms: H-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;NPY (2-36) (HUMAN, RAT);NEUROPEPTIDE Y (2-36) (HUMAN, RAT)
• CAS NO: 123139-39-9
• Molecular Formula: C180H276N54O55S
• Molecular Weight: 0
• Product Categories: peptide
• Mol File: 123139-39-9.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Storage Temp.: -15°C
• CAS DataBase Reference: NEUROPEPTIDE Y (2-36) (HUMAN, RAT)(CAS DataBase Reference)
• NIST Chemistry Reference: NEUROPEPTIDE Y (2-36) (HUMAN, RAT)(123139-39-9)
• EPA Substance Registry System: NEUROPEPTIDE Y (2-36) (HUMAN, RAT)(123139-39-9)

Safety Data

• Hazardous Substances Data: 123139-39-9(Hazardous Substances Data)

Usage

General Description

NEUROPEPTIDE Y (2-36) is a two to thirty-six amino acid fragment of the neuropeptide Y (NPY) peptide, which is a neurotransmitter in the central and peripheral nervous systems. It is found in both human and rat species. This fragment has been studied for its role in various physiological functions, including the regulation of food intake, energy balance, and stress response. Additionally, research has shown that NEUROPEPTIDE Y (2-36) may have potential therapeutic applications in conditions such as obesity, diabetes, and anxiety disorders. Overall, NEUROPEPTIDE Y (2-36) is an important molecule with diverse physiological effects and potential therapeutic implications.