1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

Our main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block

Product Name: AMYLIN, HUMAN Synonyms: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (DISULFIDE BRIDGE: 2-7);LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-HIS-SER-SER-ASN-ASN-PHE-GLY-ALA-ILE-LEU-SER-SER-THR-ASN-VAL-GLY

WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

AMYLIN, HUMAN CAS:122384-88-7 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high quality organic intermedi

Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,

GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

1.Applied in food field.it can improve the immune system and prolong life. 2.Appliedin cosmetic field.it can improve the skin care. 3.Applied in pharmaceutical field.it can treat various dieases. 4.Our product quality assurance will make our customer

High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

High purity, high success rate, short cycle and moderate priceAppearance:White powder solid Storage:Negative 20 degrees Celsius Package:5mg, 10mg 100mg, 1gram Application:Applied to various scientific research

Lower price, sample is available,SDS test documents are available,large stock in warehouseAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:Fine chemical intermediates, used as the main raw material for the synthe

High-quality peptides at competitive prices.Appearance:Powder Storage:-20℃ Package:PP bags inside,outside aluminium foil bag Application:Intermediate,peptides Transportation:Express, sea, air, land. Port:Shanghai,China

high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

Ansciep Chemical is a professional enterprise manufacturing and distributing fine chemicals and speciality chemicals. We have been dedicated to heterocycle compounds and phenyl rings for tens of years. This is our mature product for export. Our quali

good quality, competitive price, thoughtful after sale serviceAppearance:white powder Storage:Keep it in dry,shady and cool place Package:25kg,50kg,180kg,200kg,250kg,1000kg，customization Application:Pharma;Industry;Agricultural;chemical reaserch Tran

Supply top quality products with a reasonable price Application:api

factory?direct?saleAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:healing drugs Transportation:By sea Port:Shanghai/tianjin

good quality, competitive price, thoughtful after sale serviceAppearance:white powder Storage:Keep it in dry,shady and cool place Package:1mg Application:Pharma;Industry;Agricultural;chemical reaserch Transportation:by express or by sea Port:Any port

factory?direct?saleAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:healing drugs Transportation:By sea Port:Shanghai/tianjin

Shanghai Apeptide Co.,Ltd is one of famous-peptide manufacturers in China. For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc... Our website address: www.apeptides.com/en/ We have amyloid peptides

Wuhan Sun-shine Bio-technology Corporation Limited is specializing in the anticancer, antitumor,heart head blood-vessel，pharmaceutical intermediates，fine Chemicals production and customization. Company has strong ability of research and development

Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers. Our advantages:1, High quality with competitive price:1) Standard:BP/USP/EP/Enterprise standard2) All Purity≥99%3) We are manufacturer

Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

Price, service, company and transport advantage: 1. Best service, place of origin China, high quality, and reasonable price. 2. It's customers' right to choose the package (EMS, DHL, FEDEX, UPS). 3. It's customers' right

We have strong R&D center which can support and provide custom synthesis accordingly such as fine chemicals,biotechnique , pharmaceuticals etc.We can provide free sample for our clients to test anf verify the quality of our goods.LongyuChem holds str

Wuhan Senwayer century chemical Co..Ltd located in the predominant Wuhan City where is a traffic hinge of China, specialize in producing and developing pharmaceutical & its intermediates, Pesticide Intermediate, food additive, Plant extracts,and