86168-78-7 Sermorelin C149H246N44O42S
Our company was built in 2009 with an ISO certificate.In the past 5 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.Our main business covers the fields below:
1.Noble Metal Catalysts (Pt.Pd...)
2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)
3.OLED intermediates (Fluorene,Carbazole,Boric acid...)
4.Customs Synthesis
Our advantage:
1. Higest quality and good package
2.Fast delivery
3.Better payment term
4.Fast response to customer within 6 hours
5.Good business credit in Europe ,US ,Japan ,Korea
Anyway ,if you need any chemicals from China ,Henan Tianfu can help you
Sermorelin Basic information
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
EINECS:
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File: 86168-78-7.mol
Sermorelin Structure
Sermorelin Chemical Properties
storage temp. −20°C
CAS DataBase Reference 86168-78-7(CAS DataBase Reference)
Safety Information
WGK Germany 3
MSDS Information
Provider Language
SigmaAldrich English
Sermorelin Usage And Synthesis
Usage xanthine oxidase inhibitor
Our company was built in 2009 with an ISO certificate.In the past 5 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.Our main business covers the fields below:
1.Noble Metal Catalysts (Pt.Pd...)
2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)
3.OLED intermediates (Fluorene,Carbazole,Boric acid...)
4.Customs Synthesis
Our advantage:
1. Higest quality and good package
2.Fast delivery
3.Better payment term
4.Fast response to customer within 6 hours
5.Good business credit in Europe ,US ,Japan ,Korea
Anyway ,if you need any chemicals from China ,Henan Tianfu can help you
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View