Sermorelin 86168-78-7 C149H246N44O42S
Our Services
1.Certificate Of Analysis (COA)
2.Material Safety Data Sheet (MSDS)
3.Route of synthesis (ROS)
4.Method of Aanlysis (MOA)
5.Nuclear Magnetic Resonance (NMR)
6.Packing pictures and loading video before loading
7.Free Sample
9.Factory audit
10.Strong after-sale service
Company information
Henan Sunlake Enterprise Corporation is located in Henan Province , The central plain of China , Which enjoys favorable geogeaphical position and convenient transportion, The com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs , Water treatment chemicals , Food & FEED additives and others . these products have been being well exported to europe , southeast Asia , the Middle East , Africa , South America and some other countries and areas.We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team, who are professional engineers and scholars with Ph. D. .So we are confident to serve you better with our high - quality products and professional team.We are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market.We welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate.
Sermorelin Basic information |
Product Name: | Sermorelin |
Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) |
CAS: | 86168-78-7 |
MF: | C149H246N44O42S |
MW: | 3357.88 |
EINECS: | |
Product Categories: | Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors |
Mol File: | 86168-78-7.mol |
|
Sermorelin Chemical Properties |
storage temp. | −20°C |
CAS DataBase Reference | 86168-78-7(CAS DataBase Reference) |
Safety Information |
WGK Germany | 3 |
MSDS Information |
Provider | Language |
---|---|
SigmaAldrich | English |
Sermorelin Usage And Synthesis |
Usage | xanthine oxidase inhibitor |
Sermorelin Preparation Products And Raw materials |
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View