Sermorelin

Sermorelin

Sermorelin

Min.Order / FOB Price:Get Latest Price

1 Kilogram

Negotiable

  • Min.Order :1 Kilogram
  • Purity: 98%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

Sermorelin 86168-78-7 manufacturer , better price with good quality

Quick Details

  • Appearance:solid
  • Application:Organic Chemistry
  • PackAge:Depended
  • ProductionCapacity:300|Kilogram|Month
  • Storage:?20°C
  • Transportation:BY SEA OR AIR

Superiority:

Sermorelin Basic information
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
EINECS:  
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File: 86168-78-7.mol
Sermorelin Structure
 
Sermorelin Chemical Properties
storage temp.  −20°C
CAS DataBase Reference 86168-78-7(CAS DataBase Reference)
 
Safety Information
WGK Germany  3
MSDS Information
Provider Language
SigmaAldrich English
 
Sermorelin Usage And Synthesis
Usage xanthine oxidase inhibitor
 
Sermorelin Preparation Products And Raw materials

 

Details:

Henan Sunlake Enterprise Corporation is located in Henan Province, the central plain of China , Which enjoys favorable geogeaphical position and convenient transportion. The comany was established in june 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .
     Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs ,  Water treatment chemicals , Food & FEED additives and others . These products have been being well exported to Europe , Southeast Asia , the Middle East ,  Africa , South America and some other countries and areas.
    We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team who are professional engineers and scholars with Ph. D. .So we are confident to serve you  better with our high - quality products and professional team.
    We are taking great efforts to provide our customers with demanded goods and professional services, continuously improve our core ability of competition and get the momentum for sustainable development ,Which finally makes us being a reliable and professional supplier in international market.
     We welcome any inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!
 
Our Advantages:
I). We have abundant professional production experience.
II). We have our own chemical factory.
III). Sample is free of charge.
IV). Reasonable Price, Excellent Quality & Attentive Service
V). Prompt reply: we can reply your inquiry and email within 24 hours.
VI). Fast Delivery: The delivery time is about 10-20 days after receiving the deposit.
VII). We have passed the LFGB, SGS, STC, HSL and some other tests.
VIII). We have a unity cooperation team.
 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View