Teriparatide acetate

Teriparatide acetate

Teriparatide acetate

Min.Order / FOB Price:Get Latest Price

1 Kilogram

Negotiable

  • Min.Order :1 Kilogram
  • Purity: 98%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

Teriparatide acetate 52232-67-4 manufacturer , better price with good quality

Quick Details

  • Appearance:powder
  • Application:Organic Chemistry
  • PackAge:Depended
  • ProductionCapacity:300|Kilogram|Month
  • Storage:?20°C
  • Transportation:BY SEA OR AIR

Superiority:


Preview
CBNumber: CB2284468
Chemical Name: Teriparatide acetate
Molecular Formula: C172H278N52O47S2
Formula Weight: 3890.49792
CAS No.: 52232-67-4
Teriparatide acetate Basic information
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS:  
Product Categories: Amino Acid Derivatives;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;EndocrinologyandHormones;proteins
Mol File: 52232-67-4.mol
Teriparatide acetate Structure
 
Teriparatide acetate Chemical Properties
storage temp.  −20°C
form  powder
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)
 
Safety Information
WGK Germany  3
Hazardous Substances Data 52232-67-4(Hazardous Substances Data)
MSDS Information
Provider Language
SigmaAldrich English
 
Teriparatide acetate Usage And Synthesis
Usage A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
 
Teriparatide acetate Preparation Products And Raw materials
 

 

Details:

Henan Sunlake Enterprise Corporation is located in Henan Province, the central plain of China , Which enjoys favorable geogeaphical position and convenient transportion. The comany was established in june 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .
     Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs ,  Water treatment chemicals , Food & FEED additives and others . These products have been being well exported to Europe , Southeast Asia , the Middle East ,  Africa , South America and some other countries and areas.
    We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team who are professional engineers and scholars with Ph. D. .So we are confident to serve you  better with our high - quality products and professional team.
    We are taking great efforts to provide our customers with demanded goods and professional services, continuously improve our core ability of competition and get the momentum for sustainable development ,Which finally makes us being a reliable and professional supplier in international market.
     We welcome any inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!
 
Our Advantages:
I). We have abundant professional production experience.
II). We have our own chemical factory.
III). Sample is free of charge.
IV). Reasonable Price, Excellent Quality & Attentive Service
V). Prompt reply: we can reply your inquiry and email within 24 hours.
VI). Fast Delivery: The delivery time is about 10-20 days after receiving the deposit.
VII). We have passed the LFGB, SGS, STC, HSL and some other tests.
VIII). We have a unity cooperation team.
 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View