Details:
Calcitonin salmon Basic information |
Product Name: |
Calcitonin salmon |
Synonyms: |
CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7) |
CAS: |
47931-85-1 |
MF: |
C145H240N44O48S2 |
MW: |
3431.85 |
EINECS: |
256-342-8 |
Product Categories: |
Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor |
Mol File: |
47931-85-1.mol |
 |
|
Calcitonin salmon Chemical Properties |
Safety Statements |
22-24/25 |
WGK Germany |
3 |
RTECS |
EV8000000 |
F |
3-10 |
|
Calcitonin salmon Usage And Synthesis |
Usage |
Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease) |
|
Calcitonin salmon Preparation Products And Raw materials |
HenNan sunlake enterprise corporation is located in Henan Province , The central plain of China , Which enjoys favorable geogeaphical position and convenient transportion, The com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .
Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs , Water treatment chemicals , Food & FEED additives and others . these products have been being well exported to europe , southeast Asia , the Middle East , Africa , South America and some other countries and areas.
We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team, who are professional engineers and scholars with Ph. D. .So we are confident to serve you better with our high - quality products and professional team.
We are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market. We welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!