47931-85-1 ...

47931-85-1 C145H240N44O48S2 Calcitonin salmon
47931-85-1 C145H240N44O48S2 Calcitonin salmon
47931-85-1 C145H240N44O48S2 Calcitonin salmon
47931-85-1 C145H240N44O48S2 Calcitonin salmon
47931-85-1 C145H240N44O48S2 Calcitonin salmon

47931-85-1 C145H240N44O48S2 Calcitonin salmon

Min.Order / FOB Price:Get Latest Price

10 Gram

Negotiable

  • Min.Order :10 Gram
  • Purity: 99%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

47931-85-1 C145H240N44O48S2 Calcitonin salmon 47931-85-1 C145H240N44O48S2

Quick Details

  • Appearance:white powder
  • Application:Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)
  • PackAge:Woven bag
  • ProductionCapacity:1|Kilogram|Day
  • Storage:Normal temperature
  • Transportation:Ocean shipping Express delivery

Superiority:

Calcitonin salmon Basic information
Product Name: Calcitonin salmon
Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
CAS: 47931-85-1
MF: C145H240N44O48S2
MW: 3431.85
EINECS: 256-342-8
Product Categories: Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor
Mol File: 47931-85-1.mol
Calcitonin salmon Structure
 
Calcitonin salmon Chemical Properties
storage temp.  −20°C
solubility  0.05 M acetic acid: 1 mg/mL, clear, colorless
form  powder
Merck  13,1642
CAS DataBase Reference 47931-85-1(CAS DataBase Reference)
 
Safety Information
Safety Statements  22-24/25
WGK Germany  3
RTECS  EV8000000
F  3-10
MSDS Information
Provider Language
SigmaAldrich English
 
Calcitonin salmon Usage And Synthesis
Usage Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)
 
Calcitonin salmon Preparation Products And Raw materials

 

Details:

Calcitonin salmon Basic information
Product Name: Calcitonin salmon
Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
CAS: 47931-85-1
MF: C145H240N44O48S2
MW: 3431.85
EINECS: 256-342-8
Product Categories: Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor
Mol File: 47931-85-1.mol
Calcitonin salmon Structure
 
Calcitonin salmon Chemical Properties
storage temp.  −20°C
solubility  0.05 M acetic acid: 1 mg/mL, clear, colorless
form  powder
Merck  13,1642
CAS DataBase Reference 47931-85-1(CAS DataBase Reference)
 
Safety Information
Safety Statements  22-24/25
WGK Germany  3
RTECS  EV8000000
F  3-10
MSDS Information
Provider Language
SigmaAldrich English
 
Calcitonin salmon Usage And Synthesis
Usage Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)
 
Calcitonin salmon Preparation Products And Raw materials
   HenNan sunlake enterprise corporation is located in Henan Province , The central plain of China , Which enjoys favorable geogeaphical position and convenient transportion, The com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material . 
   Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs , Water treatment chemicals , Food & FEED additives and others . these products have been being well exported to europe , southeast Asia , the Middle East , Africa , South America and some other countries and areas. 
    We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team, who are professional engineers and scholars with Ph. D. .So we are confident to serve you better with our high - quality products and professional team. 
     We are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market. We welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!
 

View All
Visit Store

You Might Also Like

Related Searches

Contact Supplier

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View