Offer 86168-78-7 C1...

Offer 86168-78-7 C149H246N44O42S  Sermorelin
Offer 86168-78-7 C149H246N44O42S  Sermorelin
Offer 86168-78-7 C149H246N44O42S  Sermorelin
Offer 86168-78-7 C149H246N44O42S  Sermorelin
Offer 86168-78-7 C149H246N44O42S  Sermorelin

Offer 86168-78-7 C149H246N44O42S Sermorelin

Min.Order / FOB Price:Get Latest Price

1 Kilogram

FOB Price:USD 750.0000 -850.0000

  • Min.Order :1 Kilogram
  • Purity: 98% purity
  • Payment Terms : L/C,T/T,Other

Keywords

Buy 86168-78-7 Sermorelin 99% purity Supply 86168-78-7 Sermorelin with stable production Hot sale ! 86168-78-7 for pharmaceutical intermediates

Quick Details

  • Appearance:white crystalline powder
  • Application:86168-78-7 1>Pharmaceutical raw materials and 2>pharmaceutical intermediates, 3>electronic chemicals, 4>fine chemicals 5>Organic Light Emitting Display(Oled) 6>Noble metal catalysts
  • PackAge:1g;5g;10g;25g;50g;100g;500g;1KG;5KG,25kg,50kg or as customers request
  • ProductionCapacity:50|Kilogram|Month
  • Storage:2-8, cold storage, to avoid light storage.
  • Transportation:BY SEA /BY AIR /BY COURIER

Superiority:

1. ISO 9001 approved, GMP producing standard,Proffesional QA system, our quality is guaranteed.

2. Facotory direct sale, most comptive price ensured;

3. Audited Supplier on lookchem, No trick, No Scam!

4. Enough stock can make sure safe delivery.

5. Complete before and after sale service, welcome your questions and glad to help.

Offer 86168-78-7

Details:

PRODUCT INFORMATION :

Sermorelin Basic information
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
EINECS:  
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File: 86168-78-7.mol
Sermorelin Structure
 
Sermorelin Chemical Properties
storage temp.  −20°C
CAS DataBase Reference 86168-78-7(CAS DataBase Reference)
 
Safety Information
WGK Germany  3
MSDS Information
Provider Language
SigmaAldrich English
 
Sermorelin Usage And Synthesis
Usage xanthine oxidase inhibitor

COMPANY INFORMATION :

HenNan sunlake enterprise corporation is located in Henan Province , The central plain of China , Which enjoys favorable geogeaphical position and convenient transportion, The com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material . 
Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs , Water treatment chemicals , Food & FEED additives and others . these products have been being well exported to europe , southeast Asia , the Middle East , Africa , South America and some other countries and areas. 

superiority :

1. Production capacity: we have three production base with high-tech production equipment and instruments, equipped with professional production personnel, meet your requirements.
2. Quality assurance: we have a first-class testing equipment and testing personnel, in strict accordance with ISO and cGMP standards, ensure that the quality of the shipment.
3.Ultra-low prices, we follow the meager profit but high turnover principle to win more customers, to provide you with quality and cheap products.
4.The best service: we can real-time quotation, tracking service, ensure the safety of the goods to the clients.
5. Customer groups: our clients throughout the world more than 30 countries, high quality products, low price, best service to win the customer's consistent high praise.
If you demand the product, you are welcome to contact us at any time, we guarantee that you seriously every inquiry, give you the fastest reply and the best service.

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View