Exendin-4 141758-74-9 C184H282N50O60S1
Our company engages in Sodium Tripolyphosphate (STPP) and Sodium Hexametabphosphate (SHMP) production; development of noble metal catalysts, synthesis of electronic chemical materials and general chemicals Imp&Exp trading business. The company is located in Zhengzhou High-tech Development Zone with import and export license. We passed ISO 9001:2008 in 2009, and won "High-tech Enterprise" by provincial government in 2013. Our STPP and SHMP has reached an annual output of 30000 tons and has successfully passed SGS, CIQ audits on many occasions.
In 2011 we entered the fine chemical market of Noble Metal Catalyst ,Organic Phosphine Ligands and OLED intermediates.With the joint efforts of our senior experts and professional technicians, Tianfu has developed more than 500 compounds, which are widely used in the fields of production and life science. The objective of the company is to put quality first and put our customer’s needs first - the satisfaction of our customers is the company's ultimate goal. Improving product quality and service level is our responsibility, and creating more value for our customer’s is our purpose. We are constantly striving to make Henan Tianfu a leading chemical supplier, and hope to create a better future with you.
Exendin-4 Basic information |
Product Name: | Exendin-4 |
Synonyms: | H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;Exenatide, AC 2993, Exendin A, ExendinA;H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2;Exendin-4 Exenatide |
CAS: | 141758-74-9 |
MF: | C184H282N50O60S1 |
MW: | 4186.57 |
EINECS: | |
Product Categories: | Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors |
Mol File: | Mol File |
Exendin-4 Chemical Properties |
storage temp. | −20°C |
Safety Information |
WGK Germany | 3 |
MSDS Information |
Provider | Language |
---|---|
SigmaAldrich | English |
Exendin-4 Usage And Synthesis |
New diabetes drugs |
Diabetes is a metabolic disorder characterized by chronic hyperglycemia caused by a variety of causes , high blood sugar is caused by insulin secretion or its effect defect. Diabetes can be divided into type 1 diabetes, type 2 diabetes, other specific types of diabetes, and gestational diabetes, among which type 2 diabetes account for more than 90%. Exendin-4 is a new diabetes drug successfully developed by American Eli Lilly Company it belongs to incretin analogues, it is the first member of the incretin analogues family , it is the synthetic peptide compound, which can simulate physiological behavior of the natural state secretion of GLP-1 in vivo ,it is similar to human pancreatic glucagon-like peptide effect -1 (GLP-1),it can promote glucose-dependent insulin secretion, it has inhibition effect of inappropriate glucose-dependent glucagon secretion, slowing gastric emptying, it improves the sensitivity of peripheral tissues to insulin, and it makes blood sugar adequately controlled. Clinically it is used for the treatment of type Ⅱ diabetes patients whose blood sugar is unbale to be controlled by metformin, sulfonylurea, or combination of metformin and sulfonylurea. From April 28, 2005 to October 29, 2008, the US Food and Drug Administration (abbreviation: FDA) Adverse Event Reporting System had received reports of 78 cases of patients with renal exenatide change. In the meantime, the United States had made a total of more than 6.6 million Exendin-4 prescription, therefore, FDA thought the received 78 cases was in a small proportion of the proportion of all patients reporting use of the drug. Currently FDA has completed an assessment of these reported cases, including 62 cases of acute renal failure cases and 16 cases of renal insufficiency cases. Acute renal failure or renal dysfunction occurs three days to two years after treatment. The age span is 23 years to 83 years, mean age is 60 years. The above information is edited by the chemicalbook of Tian Ye. |
Application | Exendin-4 can activate the GLP-1 receptor, the receptor can increase cAMP levels of pancreatic acinar cells in intracellular , but it has no effect on VIP receptor. |
Exendin-4 Preparation Products And Raw materials |
CAS NO:114435-02-8
CAS NO:1541-67-9
CAS NO:423-55-2
CAS NO:1438-82-0
CAS NO:124-41-4
CAS NO:409071-16-5
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View