GRF (1-44) (HUMAN) 83930-13-6 C215H358N72O66S1
GRF (1-44) (HUMAN) Basic information |
Product Name: | GRF (1-44) (HUMAN) |
Synonyms: | SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN (HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH |
CAS: | 83930-13-6 |
MF: | C215H358N72O66S1 |
MW: | 5039.65 |
EINECS: | |
Product Categories: | Peptide;VIP and PACAP receptor;peptides pharm |
Mol File: | Mol File |
GRF (1-44) (HUMAN) Chemical Properties |
storage temp. | −20°C |
form | powder |
Safety Information |
WGK Germany | 3 |
We have clients throughout the world:
Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet your desire.
Our Laboratoy
We have our own independent lab test center:
This makes sure that our technology support is reliable and authoritative.All of self-owned fine chemicals are manufactured strictly in accordance with international standard.,and also has scientific cooperation with local colleges and institutes.
Our factory
High quality with competitive price:
We are manufacturer and can provide high quality products with factory price
Package & Shipment
Fast and safe delivery:
Parcels can be sent out within 24 hours after payment. Tracking number is available
Secure and discreet shipment. You have various choices of transportation methods
CAS NO:54735-61-4
CAS NO:3387-36-8
CAS NO:869357-68-6
CAS NO:643-10-7
CAS NO:1420-49-1
CAS NO:14985-44-5
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View