GRF (1-44) (HUMAN)

GRF (1-44) (HUMAN)
GRF (1-44) (HUMAN)
GRF (1-44) (HUMAN)

GRF (1-44) (HUMAN)

Min.Order / FOB Price:Get Latest Price

1 Kilogram

Negotiable

  • Min.Order :1 Kilogram
  • Purity: 98%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

GRF (1-44) (HUMAN) 83930-13-6 C215H358N72O66S1

Quick Details

  • Appearance:powder
  • Application:83930-13-6
  • PackAge:As requested
  • ProductionCapacity:300|Kilogram|Day
  • Storage:-20°C
  • Transportation:By air or by sea

Superiority:

 
GRF (1-44) (HUMAN) Basic information
Product Name: GRF (1-44) (HUMAN)
Synonyms: SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN (HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
CAS: 83930-13-6
MF: C215H358N72O66S1
MW: 5039.65
EINECS:  
Product Categories: Peptide;VIP and PACAP receptor;peptides pharm
Mol File: Mol File
 
 
GRF (1-44) (HUMAN) Chemical Properties
storage temp.  −20°C
form  powder
 
Safety Information
WGK Germany  3

 

Details:

  • Exhibition in shanghai

We have clients throughout the world:

Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet your desire.

Our Laboratoy

We have our own independent lab test center:

This makes sure that our technology support is reliable and authoritative.All of self-owned fine chemicals are manufactured strictly in accordance with international standard.,and also has scientific cooperation with local colleges and institutes.

 

 

Our factory

High quality with competitive price:

We are manufacturer and can provide high quality products with factory price

Package  & Shipment

Fast and safe delivery:

Parcels can be sent out within 24 hours after payment. Tracking number is available

Secure and discreet shipment. You have various choices of transportation methods

 

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View