Crf (human, rat) Acetate; Generic Peptide; Cosmetic Peptide
Min.Order / FOB Price:Get Latest Price
| 1 Gram |
FOB Price: USD 15.0000 |
- Min.Order :1 Gram
- Purity: 99%
- Payment Terms : T/T,Other
Keywords
Peptides Pharmaceutical Intermediate Chemical
Quick Details
- Appearance:White Powder
- Application:bodybuilding pharmaceutical material, Steroid hormone, Anabolin. As a male hormone and anabolic hormones.
- PackAge:Packaging can be according to customer
- ProductionCapacity:10000|Metric Ton|Day
- Storage:Keep it under seal in cool and dark place
- Transportation:FEDEX DHL TNT UPS EUB
Superiority:
This is Allen from Zhengzhou Filter Biotechnology Co.,Ltd.We are the professional supplier of peptide products in China over 10 years. we have Professional Lab to confirm the Quality and Serive for all clients in long-term run cooperation.
Our Company as a Pharmaceutical Raw Material Manufacturer specialize in R&D the New Drugs and Producing the Generic Medicine:
Amino Acids&Vitamins
Pharmaceutical Polypeptide,
Comestic Polypeptide,
Veterinary Peptide and
Pharmaceutical APIs.
Due to of the high quality and good service, They have been exported more than 30 countries.
Sincerely hope to have a chance to cooperate with you
Details:
Description
CRF (human rat) Acetate
Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Form: White powder
Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2aand mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Licensing Information
Sold with the permission of the SALK Institute
Technical Data
M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
(Modifications: Ile-41 = C-terminal amide)
Solubility:
Soluble to 1.10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
86784-80-7
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
You Might Also Like
-
Good Quality for 99% Purity GMP Certified CAS 71447-49-9 Gonadorelin Acetate(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
High Purity for 99% Purity Gonadorelin, Gonadorelin Acetate, Peptide, 71447-49-9(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
Quality for 99% Purity Pharmaceutical Peptide Epitalon Product From China(307297-39-8)
CAS NO:307297-39-8
-
Quality for 99% Purity High Quality CAS 141732-76-5 Exenatide Acetate Peptide(141732-76-5)
CAS NO:141732-76-5
-
Quality for 99% Purity Felypressin Acetate /56-59-7 / C46h65n13o11s2 Peptide(56-59-7)
CAS NO:56-59-7
-
Quality for 99% Purity Pharmaceutical Peptide Selank Powder 99% Purity Anxiolytic CAS: 129954-34-3(129954-34-3)
CAS NO:129954-34-3
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View