Sermorelin Acetate by lab
Min.Order / FOB Price:Get Latest Price
| 1 Gram |
FOB Price:USD 5.0000 -10.0000 |
- Min.Order :1 Gram
- Purity: 99%
- Payment Terms : L/C,D/A,D/P,T/T,
Keywords
Sermorelin Sermorelin Acetate peptide
Quick Details
- Appearance:white powder
- Application: research by lab
- PackAge:1kg/Aluminium foil bag or Customized
- ProductionCapacity:1|Metric Ton|Week
- Storage:Store in a cool, dry and ventilated pl.
- Transportation:by air/express /sea
Superiority:
Filter is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China.
2. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air and by Sea,we ensure that we meet the customer expectations with promptness.
3. Our company facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service.
4. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.
Details:
| Product Name: | Generic Peptide Sermorelin Aceta |
| Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) |
| CAS: | 86168-78-7 |
| MF: | C149H246N44O42S |
| MW: | 3357.88 |
| EINECS: | -- |
| Product Categories: | Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors |
| Purity: | 99%,98% |
|
|
Sermorelin , also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.It is used as a diagnostic agent to assess growth hormone (GH) secretion. It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue. Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.
Uses
Sermorelin is used to treat growth problems (usually in children) due to growth hormone deficiency. It works by stimulating the pituitary gland to release more natural growth hormone.
<
| Product Range |
Product Name English |
| Testosterone Series | Testosterone base |
| Testosterone Acetate | |
| Testosterone Cypionate | |
| Testosterone Decanoate | |
| Testosterone Enanthate | |
| Testosterone Phenylpropionate | |
| Testosterone Propionate | |
| Testosterone Isocaproate | |
| Testosterone Undecanoate | |
| Methyl Testosterone | |
| Sustanon | |
| Nandrolone Series | Nandrolone base |
| Nandrolone Decanoate | |
| Nandrolone Phenylpropionate | |
| Nandrolone Uncecanoate | |
| Nandrolone Enanthate | |
| Nandrolone Cypionate | |
| Nandrolone Propionate | |
| Boldenone Series | Boldenone base |
| Boldenone Undecylenate | |
| Boldenone Acetate | |
| Boldenone Cypionate | |
| Boldenone Propionate | |
| Trenbolone Series | Trenbolone base |
| Trenbolone Acetate | |
| Trenbolone Enanthate | |
| Trenbolone Cyclohexylmethylcarbonate | |
| Metribolone(Methyl Trenbolone) | |
| Altrenogest(17a‐allyl‐trenbolone) | |
| DHEA Series | DHEA Acetate |
| DHEA | |
| Epiandrosterone | |
| 7-keto DHEA | |
| 7-keto DHEA acetate | |
| DHEA Sulphate Sodium | |
| Metenolone Series | Metenolone Acetate |
| Metenolone Enanthate | |
| Other Products | 4AD（4-androstenedione） |
| ADD（Androsta-1,4-diene-3,17-dione) | |
| Oxymetholone | |
| Stanozolol | |
| Methandienone | |
| Oxandrolone | |
| Mesterolone | |
| Fluoxymesterone | |
| Estrogen | Estradiol |
| Estriol | |
| Estrone | |
| Other Compounds | Methyl Drostanolone |
| Drostanolone Propionate | |
| Drostanolone Enanthate | |
| Methylstenbolone | |
| Non‐steroids | Clomifen |
| Tamoxifen |
About us
Shipping 
Cassie is here to give you my better service and producst
Whatsapp+8615294859659
You Might Also Like
-
Good Quality for 99% Purity GMP Certified CAS 71447-49-9 Gonadorelin Acetate(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
High Purity for 99% Purity Gonadorelin, Gonadorelin Acetate, Peptide, 71447-49-9(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
Quality for 99% Purity Pharmaceutical Peptide Epitalon Product From China(307297-39-8)
CAS NO:307297-39-8
-
Quality for 99% Purity High Quality CAS 141732-76-5 Exenatide Acetate Peptide(141732-76-5)
CAS NO:141732-76-5
-
Quality for 99% Purity Felypressin Acetate /56-59-7 / C46h65n13o11s2 Peptide(56-59-7)
CAS NO:56-59-7
-
Quality for 99% Purity Pharmaceutical Peptide Selank Powder 99% Purity Anxiolytic CAS: 129954-34-3(129954-34-3)
CAS NO:129954-34-3
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View