High purity custom ...

High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics
High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics
High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics
High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics
High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics

High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics

Min.Order / FOB Price:Get Latest Price

50 Milligram

FOB Price: USD 100.0000

  • Min.Order :50 Milligram
  • Purity: 95%MIN
  • Payment Terms : L/C,T/T,

Keywords

foxo4-dri foxo4 Senolytics

Quick Details

  • Appearance:White powder
  • Application:Active pharmaceutical intermediate
  • PackAge:1gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton
  • ProductionCapacity:1000|Gram|Month
  • Storage:1000g/Month
  • Transportation:

Superiority:

High purity custom peptide FOXO4,FOXO4-DRI,Senolytics
 
 
 
FOXO4 D-Retro-Inverso peptide,
 
also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
 
 

Other hot sale peptides:

 

Anti-aging skincare peptide Acetyl Hexapeptide-3 Argireline Cas: 616204-22-9

 

SYN-AKE Cas:823202-99-9

 

Anti-wrinkle peptide powder Acetyl Octapeptide-3 SNAP-8 Cas 868844-74-0

 

Skin Lightening-whitening Nonapeptide-1 Melanostatine

 

Skin whitening peptide Decapeptide-12 Lumixyl

 

Anti hair loss ingredient Procapil Biotinoyl Tripeptide-1 Biotin-GHK

 

Eyelash growth peptide Myristoyl Pentapeptide-17

 

Matrixyl 3000 powder CAS: 77727-17-4

 

Collagen hexapeptide Collaxyl Hexapeptide-9

 

Acetyl Hexapeptide-38/Adifyline for breast enlargement

 

Semax and N-Acetyl Semax/CAS:4037-01-8 80714-61-0

 

api Melanotan II and melanotan 2 in pharmaceutical grade

 

TB-500(Thymosin beta-4)

 

Bremelanotide CAS 32780-32-8 PT141

 

Liraglutide DMF preparation CAS : 204656-20-2

 

FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide

 
 
 
 
Order process

1. Send us your request

2.Confirm price,delivery time,payment term,your request and all details you care

3.Sign contract and issue invoice

4.Payment by your side

5.We arrange shipment immediately after confirm payment

6.Delivery( door to door,around 5 working days)

7.Follow-up service

 

Packing

1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

 

 

 

Courier

We will use your favorite courier,such as DHL,UPS,TNT,FEDEX  or EMS. Shipping by Air is also available.

 

 

 Contact info:

PH/WhatsApp/Skype/Wechat:+86-18108235634

cecilia(at)youngshechem.com

 

Details:

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.Youngshe Chem provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredients and related.

 

View All
Visit Store

You Might Also Like

Related Searches

Contact Supplier

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View