Pharmaceutical raw material CRF (human,rat)

Pharmaceutical raw material CRF (human,rat)

Min.Order / FOB Price:Get Latest Price

1 Gram	FOB Price: USD 1.0000

1 Gram

FOB Price: USD 1.0000

Min.Order :1 Gram
Purity: 98%
Payment Terms : L/C,T/T,,MoneyGram,Other

Keywords

CRF (human,rat) Corticotropin releasing factor 86784-80-7

Quick Details

Appearance:white powder
Application:Active Pharmaceutical Intermediate
PackAge:glass/plastic bottle protected by bubble film
ProductionCapacity:500|Gram|Week
Storage:2~8 ℃
Transportation:FedEx/DHL/EMS or by air.

Superiority:

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.

Details:

Product Description:

CRF(human,rat),Corticotropin releasing factor

Cas No: 86784-80-7

Formula: C208H344N60O63S2

Molecular: 4757.45

Sequence:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH?

Purity:98%

Appearance: white powder

Source: synthetic

Also know as Corticoliberin, Corticorelin, CRF-41, CRH

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Shipping:

FedEx/DHL/EMS or by air.

Packaging:

glass/plastic bottle protected by bubble film

Our Services:

More details or free sample, feel free to contact Sylvia:-)

View All

Visit Store

Pharmaceutical raw ...