Custom peptide Foxox4 / foxo4 dri / Senolytics

Custom peptide Foxox4 / foxo4 dri / Senolytics

Min.Order / FOB Price:Get Latest Price

1 Gram	FOB Price: USD 1.0000

1 Gram

FOB Price: USD 1.0000

Min.Order :1 Gram
Purity: 98%
Payment Terms : L/C,T/T,Other

Keywords

Senolytics Foxox4 Foxox4 DRI

Quick Details

Appearance:white powder
Application:Active Pharmaceutical Intermediate
PackAge:glass/plastic bottle protected by bubble film
ProductionCapacity:500|Gram|Week
Storage:2~8 ℃
Transportation:FedEx/DHL/EMS or by air.

Superiority:

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.

Details:

Product Description:

2017 hot sale FOX 04DRI / Senolytics

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Shipping:

FedEx/DHL/EMS or by air.

Packaging:

glass/plastic bottle protected by bubble film

Our Services:

More details or free sample, feel free to contact Sylvia:-)

View All

Visit Store

Custom peptide Foxo...