CasNo.114466-38-5,High pure Sermorelin Acetate powder with fast delivery from China,(114466-38-5) Suppliers

1 Gram	FOB Price: USD 1.0000

Min.Order :1 Gram
Purity: 98%
Payment Terms : L/C,T/T,

Keywords

Sermorelin Acetate 114466-38-5 Sermorelin

Quick Details

Appearance:white powder
Application:Phamaceutical Grade
PackAge:1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
ProductionCapacity:1000|Gram|Month
Storage:2-8 degree
Transportation:Normal temperature

Superiority:

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.Youngshe Chem provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredients and related

Details:

Sermorelin Acetate

name: Sermorelin Acetate

Cas No: 86168-78-7(net),114466-38-5(acetate)

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].