Min.Order / FOB Price:Get Latest Price
1 Gram |
FOB Price: USD 1.0000 |
Sermorelin Acetate 114466-38-5 Sermorelin
Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.Youngshe Chem provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredients and related
Sermorelin Acetate
name: Sermorelin Acetate
Cas No: 86168-78-7(net),114466-38-5(acetate)
Formula: C151H250N44O44S
Molecular:3417
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].
Other hot sale peptides:
Anti-aging skincare peptide Acetyl Hexapeptide-3 Argireline Cas: 616204-22-9
Anti-wrinkle peptide powder Acetyl Octapeptide-3 SNAP-8 Cas 868844-74-0
Skin whitening peptide Decapeptide-12 Lumixyl
Anti hair loss ingredient Procapil Biotinoyl Tripeptide-1 Biotin-GHK
Eyelash growth peptide Myristoyl Pentapeptide-17
Matrixyl 3000 powder CAS: 77727-17-4
Collagen hexapeptide Collaxyl Hexapeptide-9
Acetyl Hexapeptide-38/Adifyline for breast enlargement
Semax and N-Acetyl Semax/CAS:4037-01-8 80714-61-0
Bremelanotide CAS 32780-32-8 PT141
Liraglutide DMF preparation CAS : 204656-20-2
FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and issue invoice
4.Payment by your side
5.We arrange shipment immediately after confirm payment
6.Delivery( door to door,around 5 working days)
7.Follow-up service
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Paypal,,Money Gram,L/C,T/T are all acceptable.
Pls contact Cecilia for more details.
CAS NO:
CAS NO:2381089-83-2
CAS NO:
CAS NO:19246-18-5
CAS NO:97145-43-2
CAS NO:2023788-19-2
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View