Exenatide acetate manufacturer

Min.Order / FOB Price:Get Latest Price

1 Gram	Negotiable

1 Gram

Negotiable

Min.Order :1 Gram
Purity: 98% Min
Payment Terms : L/C,D/A,D/P,T/T,,MoneyGram,Other

Keywords

Exenatide acetate supplier Exenatide acetate high quality Exenatide acetate

Quick Details

Appearance:White powder
Application:pharmaceutical ingredients ,research chemicals
PackAge:According client's requirements
ProductionCapacity:1000|Gram|Month
Storage:keep sealed and keep from direct light
Transportation:According client's requirements

Superiority:

Our Advantages:

1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.

2. Samples free trial: our company welcome samples to test our quality then make regular orders.

3. Good Service: the company have 24 hours online service and feedback to our clients ontime

4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.

5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.

Details:

Name:Exenatide Acetate, Exenatida

Cas No:141732-76-5

Formula: C186H286N50O62S

Molecular:4246.62

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Purity:98%

Appearance: white powder

Source: synthetic

Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4

View All

Visit Store