Exenatide acetate supplier Exenatide acetate high quality Exenatide acetate
Our Advantages:
1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.
2. Samples free trial: our company welcome samples to test our quality then make regular orders.
3. Good Service: the company have 24 hours online service and feedback to our clients ontime
4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.
5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.
Name:Exenatide Acetate, Exenatida
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View