Teriparatide manufacturer

Min.Order / FOB Price:Get Latest Price

1 Gram	Negotiable

1 Gram

Negotiable

Min.Order :1 Gram
Purity: 0.98
Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

Teriparatide Acetate supplier Teriparatide Acetate high quality Teriparatide Acetate

Quick Details

Appearance:White powder
Application:pharmaceutical
PackAge:According client's requirements
ProductionCapacity:100|Gram|Day
Storage:keep sealed and keep from direct light
Transportation:According client's requirements

Superiority:

Our Advantages:

1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.

2. Samples free trial: our company welcome samples to test our quality then make regular orders.

3. Good Service: the company have 24 hours online service and feedback to our clients ontime

4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.

5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.

Details:

Name:Teriparatide Acetate, Teriparatida , Teriparatidum

Cas No: 52232-67-4(net),99294-94-7(acetate)

Formula: C181H291N55O51S2

Molecular: 4117.71

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Purity:98%

Appearance: white powder

Source: synthetic

Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide

Parathar,Teriparatide Acetate,Teriparatide Aventis Brand

View All

Visit Store