High Purity Peptide...

High Purity Peptide Cas 47931-85-1 Calcitonin Acetate
High Purity Peptide Cas 47931-85-1 Calcitonin Acetate
High Purity Peptide Cas 47931-85-1 Calcitonin Acetate
High Purity Peptide Cas 47931-85-1 Calcitonin Acetate
High Purity Peptide Cas 47931-85-1 Calcitonin Acetate

High Purity Peptide Cas 47931-85-1 Calcitonin Acetate

Min.Order / FOB Price:Get Latest Price

1 Gram

FOB Price: USD 300.0000

  • Min.Order :1 Gram
  • Purity: 98% min
  • Payment Terms : L/C,T/T,Other

Keywords

Calcitonin Acetate 47931-85-1 Calcitonin

Quick Details

  • Appearance:White powder
  • Application:API
  • PackAge:plastic bottle
  • ProductionCapacity:20|Gram|Month
  • Storage:Cold place
  • Transportation:DHL, FeDex and EMS

Superiority:

1, High quality with competitive price:
2, Fast and safe delivery
3.Excellent pre-sales and after-sales service
4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years
 

 

Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

Details:

Name:Calcitonin Acetate(Salmon)

Cas No: 47931-85-1(net)

Formula: C145H240N44O48S2

Molecular: 3431.85

Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin

Guarantee: Full refund if you met any quality problem

Medicine peptide and custom peptide are available! Welcom to contact us!

 

Custom peptide pls contact us!

Packaging & Shipping

            Professional packaging, the best quality and service

Company Profile

Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

Our Advantages

1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3. Professionalism of service: customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety products: We offer more than 200 peptides, including dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, copper peptide, oligopeptide and so on.

FAQ

 

Q1: Are you a manufacturer

Answer: Yes, we are factory founded on 2015.

Q2: How to contact with us  
Click the Alibaba "Contact Supplier" And then send us message the product you interest in, you will get reply within 24 hours. Or email Caroline

Q3:Which kind of payment terms do you accept
For small order,you can pay by T/T,, nomal order by T/T to our company account

Q4:Can you give me a discount price

Surely,It depend on your qty

Q5:How do you treat quality complaint

A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View