99% Calcitonin Salm...

99% Calcitonin Salmon 47931-85-1 Lower Blood Calcium

99% Calcitonin Salmon 47931-85-1 Lower Blood Calcium

Min.Order / FOB Price:Get Latest Price

10 Gram

Negotiable

  • Min.Order :10 Gram
  • Purity: 99%
  • Payment Terms : T/T,

Keywords

99% Calcitonin Salmon Calcitonin Salmon Manufacturer Lower Blood Calcium

Quick Details

  • Appearance:White Powder
  • Application: It Can Be Used As Pharmaceutical Intermediates, Or As Curing Agent Of Epoxy Resins, Etc
  • PackAge:100g/ bag, 2 kg/ bag, 25kg/ carton or as required
  • ProductionCapacity:10000|Metric Ton|Month
  • Storage:Store in sealed containers at cool & dry place. Protect from light, moisture and pest infestation.
  • Transportation:By DHL, TNT, FedEx, HKEMS, UPS, Etc

Superiority:

 

Advantages:
 
Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best service is our philosophy. We have Flexible and Untraceable payment terms. As a leading manufacture, our products have been exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Brazil, Mexico, Australia, Japan, Korea, Thailand, Indonesia, Uruguay and many other countries.

 

1. Quality.Every batch of steroid powders have tobetested by our QC(quality control) before they are allowed to sell.


2. Delivery We have stock, so we can delivery quickly at the very day when receive the payment. Within 24 hours after receiving the payment Lead time 4 or 7 days.


3. Discreet package Safelyand Professionally Disguised Package Guaranteed. For your safety and to insure delivery all products will be packed in a discreet way to prevent any suspicions, no steroids related name will appear on the parcels. high successful delivery rate.


4. Warm after-sale service Any of your question would be solved for the first as soon as possible.

 

Details:

Calcitonin salmon Basic information
Description Sequence Biological Activity Active Substance Application Indication Pharmacodynamics Mechanism of action References
Product Name: Calcitonin salmon
Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
CAS: 47931-85-1
MF: C145H240N44O48S2
MW: 3431.85
EINECS: 256-342-8
Product Categories: Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor
Mol File: 47931-85-1.mol
Calcitonin salmon Structure
 
Calcitonin salmon Chemical Properties
storage temp.  −20°C
solubility  0.05 M acetic acid: 1 mg/mL, clear, colorless
form  powder
Water Solubility  Soluble in water at 1mg/ml
Merck  13,1642
InChIKey IYTKRMFJECGBRF-LXQLIYPUSA-N
CAS DataBase Reference 47931-85-1(CAS DataBase Reference)
 
Safety Information
Safety Statements  22-24/25
WGK Germany  3
RTECS  EV8000000
3-10
 
Calcitonin salmon Usage And Synthesis
Description Calcitonin Salmon is a polypeptide hormone secreted by the ultimobranchial gland of salmon. It belongs to the calcitonin-like protein family and can be used to treat Paget's disease of bone, postmenopausal osteoporosis(fragile or brittle bones), or high levels of calcium in the blood (hypercalcemia). It appears to have actions essentially identical to calcitonins of mammalian origin, but its potency per mg is greater and it has a longer duration of action. It works mainly by Inhibiting osteoclastic bone resorption, decreasing serum calcium, and increasing renal excretion of phosphate, calcium, sodium magnesium and potassium by decreasing tubular reabsorption.
Sequence H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 acetate salt (Disulfide bond)
Biological Activity Hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin also refers as thyrocalcitonin is a 32 amino acid peptide hormone, which is present abundantly in seminal plasma compare to serum. It acts as a first messenger and hence regulate the the production of cAMP as well as mammalian sperm function. It may also facilitate the regulation of different isoforms of adenylyl cyclase. Additionally, salmon calcitonin stimulates the bone formation and inhibits the bone resorption in postmenopausal osteoporotic women.
Active Substance In humans, salmon calcitonin is more active than its human analog.
Calcitonin (salmon) positively influences bone remodelling and bone mass density due to its inhibiting effect on osteoclast activity. The beneficial effect of salmon calcitonin in the treatment of osteoporotic bone fractures is also due to the promotion of the cartilaginous phase of fracture healing and to pain relief.[www.bachem.com]
Application 1. Calcitonin salmon can be used for calcitonin receptor/cAMP assay for assessing the presence of calcitonin receptors expressed by TRAP+ cells.The product can also be used as a test compound for studying as well as comparing the impact of calcitonin gene related peptide (CGRP) and salmon calcitonin (sCT) on gastric mucosal barrier in rats exposed to cold + restraint stress (CRS). [sigma-aldrich]
2. Calcitonin, Salmon is a calcium regulating hormone secreted from mammalian thyroid parafollicular cells and in non-mammalian species from the ultimobranchial gland. Calcitonins are single chain polypeptides containing 32 amino-acid residues, showing hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. Eel calcitonin (Elcatonin) possesses a similar amino acid to that of the salmon form but is more stable than natural calcitonins because of the absence of disulfide bridges. [Santa Cruz Biotechnology]
3. It shows hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. [alfa-aesar]
4. Calcium-regulating peptide hormone released from the thyroid. Lowers calcium concentration in the blood and decreases bone resorption by osteoclasts. Used for therapeutic applications in osteoporosis. Salmon calcitonin peptide sequence differs from mammalian but is more potent.[Enzo Life Sciences, Inc.]
Indication Calcitonin Salmon Can Used in the treatment of symptomatic Paget's disease for patients unresponsive to alternate treatments or intolerant to such treatments. In addition, it is used in emergency situations when serum calcium levels must be decreased quickly until the underlying condition is identified. It can also be added to existing therapeutic regimens for hypercalcemia such as intravenous fluids and furosemide, oral phosphate or corticosteroids, or other agents. Calcitonin can be used in patients with azotemia and cases where intravenous fluids would be contraindicated due to limited cardiac reserves. Also for the treatment of post-menopausal osteoporosis in women more than 5 years post-menopause.
Pharmacodynamics Calcitonin inhibits bone resorption by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass and a reduction in plasma calcium levels. It also promotes the renal excretion of ions such as calcium, phosphate, sodium, magnesium, and potassium by decreasing tubular reabsorption. In consequence, there is an increase in the jejunal secretion of water, sodium, potassium, and chloride.
Mechanism of action Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
   
Uses Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View