youngshe profession...

youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4
youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4
youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4
youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4
youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4

youngshe professional peptide medical Exenatide Acetate, Exenatida Cas No 141732-76-5 Formula C186H286N50O62S AC 2993 Bydureon Byetta Exenatide synthetic Synthetic exendin-4

Min.Order / FOB Price:Get Latest Price

1 Gram

FOB Price: USD 10.0000

  • Min.Order :1 Gram
  • Purity: 98% min
  • Payment Terms : L/C,T/T,Other

Keywords

Exenatide Acetate Exenatida AC 2993, Bydureon, Byetta

Quick Details

  • Appearance:white powder
  • Application: medical
  • PackAge:plastic/glass bottle, aluminium foil bag or customized according to requests, well protected
  • ProductionCapacity:10000|Gram|Week
  • Storage:sealed, keep it in refrigerator at 2-8 degrees Celsius
  • Transportation:

Superiority:

Company Information

 

Chengdu YoungShe

 

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to  the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.


 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

We have a professional factory, independent research and 

 

development technology, high efficiency technology

 

 

 

Details:

1.Basic information:

Na  Name:Exenatide Acetate, Exenatida      

Cas No:141732-76-5

Formula: C186H286N50O62S

Molecular:4246.62

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Purity:98%

Appearance: white powder

Source: synthetic

Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4

2.Description:

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View