youngshe profession...

youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6  Formula C151H228N40O47
youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6  Formula C151H228N40O47
youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6  Formula C151H228N40O47
youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6  Formula C151H228N40O47
youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6  Formula C151H228N40O47

youngshe professional peptide medical GLP-1(7-37) Insulinotropin Cas No16941-32-5 106612-94-6 Formula C151H228N40O47

Min.Order / FOB Price:Get Latest Price

1 Gram

FOB Price: USD 10.0000

  • Min.Order :1 Gram
  • Purity: 98% min
  • Payment Terms : L/C,T/T,Other

Keywords

GLP-1 Insulinotropin Tglp 1

Quick Details

  • Appearance:white powder
  • Application: medical
  • PackAge:plastic/glass bottle, aluminium foil bag or customized according to requests, well protected
  • ProductionCapacity:10000|Gram|Week
  • Storage:sealed, keep it in refrigerator at 2-8 degrees Celsius
  • Transportation:

Superiority:

Company Information

 

Chengdu YoungShe

 

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to  the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.


 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

We have a professional factory, independent research and 

 

development technology, high efficiency technology

 

 

 

Details:

1.Basic information:

Na  Name:GLP-1(7-37), Insulinotropin  

Cas No:16941-32-5, 106612-94-6 (net)

Formula: C151H228N40O47

Molecular: 3355.66

Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch), 

 

2.Description:

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View