youngshe professional peptide medical GLP-1(7-36) IRP peptide Cas No 119637-73-9 107444-51-9 Formula C149H226N40O45

youngshe professional peptide medical GLP-1(7-36) IRP peptide Cas No 119637-73-9 107444-51-9 Formula C149H226N40O45

Min.Order / FOB Price:Get Latest Price

1 Gram	FOB Price: USD 10.0000

1 Gram

FOB Price: USD 10.0000

Min.Order :1 Gram
Purity: 98% min
Payment Terms : L/C,T/T,Other

Keywords

107444-51-9 GLP 1 IRP peptide

Quick Details

Appearance:white powder
Application: medical
PackAge:plastic/glass bottle, aluminium foil bag or customized according to requests, well protected
ProductionCapacity:10000|Gram|Week
Storage:sealed, keep it in refrigerator at 2-8 degrees Celsius
Transportation:

Superiority:

Chengdu YoungShe

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

We have a professional factory, independent research and

development technology, high efficiency technology

Details:

1.Basic information:

Na Name:GLP-1(7-36), IRP peptide

Cas No: 119637-73-9, 107444-51-9

Formula: C149H226N40O45

Molecular: 3297

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide,

2.Description:

View All

Visit Store

youngshe profession...