- Min.Order :10 Milligram
- Purity: 98%
- Payment Terms : T/T
Keywords
research peptide FOXO4 DRI FOXO4
Quick Details
- Appearance:White powder
- Application:lab research
- PackAge:Vials or bottle
- ProductionCapacity:|Metric Ton|Day
- Storage:
- Transportation:
Superiority:
Custom peptide synthesis FOXO4 peptide / FOXO4-DRI / Senolytics
Details:
FOXO4 D-Retro-Inverso peptide:
also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
You Might Also Like
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View