medical peptide API...

medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2
medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2
medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2
medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2
medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2

medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2

Min.Order / FOB Price:Get Latest Price

1 Gram

FOB Price: USD 10.0000

  • Min.Order :1 Gram
  • Purity: 98% min
  • Payment Terms : L/C,T/T,Other

Keywords

CRF ,Corticotropin releasing factor Corticoliberin, Corticorelin

Quick Details

  • Appearance:white powder
  • Application: medical
  • PackAge:plastic/glass bottle, aluminium foil bag or customized according to requests, well protected
  • ProductionCapacity:10000|Gram|Week
  • Storage:sealed, keep it in refrigerator at 2-8 degrees Celsius
  • Transportation:

Superiority:

Company Information

 

Chengdu YoungShe

 

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to  the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.


 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

We have a professional factory, independent research and 

 

development technology, high efficiency technology

 

 

 

Details:

1.Basic information:

Na   ame: CRF(human,rat),Corticotropin releasing factor  

Cas No: 86784-80-7

Formula: C208H344N60O63S2

Molecular: 4757.45

Sequence:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH?

Purity:98%

Appearance: white powder

Source: synthetic

Also know as: Corticoliberin, Corticorelin, CRF-41, CRH

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

2.Description:

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View