CasNo.159519-65-0,High Quality Enfuvirtide,(159519-65-0) Suppliers

1 Gram	FOB Price: USD 1.0000

Min.Order :1 Gram
Purity: 98% HPLC
Payment Terms : L/C,D/A,D/P,T/T,

Keywords

159519-65-0 Enfuvirtide Enfuvirtide Price

Quick Details

Appearance:White powder
Application:pharmaceutical intermediates
PackAge:1kg or 25Kg drum
ProductionCapacity:3000|Metric Ton|Year
Storage:Store in dry, dark and ventilated place
Transportation:By air or by sea. Prompt delivery

Superiority:

Qingdao Sigma Chemical Ltd is is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates, peptide,Nootropis etc API, food and feed additives, herbal extracts, agrochemicals and fine chemicals etc.

Our Laboratory is located in shandong province. There are 15 experts in our research team. Talented personnel and well-equipped laboratory makes rigorous and professional quality control possible. Lyphar Biotech is equipped with various detection devices, such as HPLC, GC, Spectrophotometer, AAS, Polarimeter, Auto titrators, BOD Incubators, COD Incubators, Melting point apparatus and so on.

The aim of QDSIGMA is a quality policy that "Elements in the system all have been satisfied, Personnel has been trained; Every batch of material is checked, Each procedure guarantees the quality; Every bag of our products is top grade, Service is thoughtful all the time, quality and reputation to increase market share and promote enterprise development. The quality, colors and forms of our products have reached a high level in related chemical industry, which relies on characteristic and advanced processing technology and it has gained a high and reliable reputation from customers at both quality and services.

QDSIGMA has become the "Top 500 Chinese manufacturing companies","Top 20 of global chemical sales".QDSIGMA has 21 subsidiaries and holding companies.

We promise our customer following items

1.Reasonable price:
2.Low moq:No worry about the low moq, our moq is 1 gram or lower.
3.Good and efficient service,Fast Delivery
4.Super-good quality

Details:

Product Description

Factory Supply High Quality Enfuvirtide /Enfuvirtide Acetate with Best Price CAS:159519-65-0

Product Description

Factory Supply High Quality Enfuvirtide /Enfuvirtide Acetate with Best Price CAS:159519-65-0

Name:Enfuvirtide Acetate
Cas No: 159519-65-0
Formular: C204H301N51O64
Molecular:4491.87
Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178

Enfuvirtide is a short polypeptide with activity against human immunodeficiency virus (HIV). Enfuvirtide binds to the first heptad-repeat (HR1) in the gp41 viral envelope glycoprotein, thereby preventing conformational changes required for fusion of viral and cellular membranes and preventing the virus from entering a host cell.