high quality 14175...

high quality  141758-74-9  Exendin-4   with best price

high quality 141758-74-9 Exendin-4 with best price

Min.Order / FOB Price:Get Latest Price

10 Gram

Negotiable

  • Min.Order :10 Gram
  • Purity: 99%
  • Payment Terms : T/T,,MoneyGram

Keywords

Exendin-4 141758-74-9 141758-74-9 Exendin-4

Quick Details

  • Appearance:White Crystalline Powder
  • Application: It Can Be Used As Pharmaceutical Intermediates Etc
  • PackAge:100g/ bag, 2 kg/ bag, 25kg/ carton or as required
  • ProductionCapacity:1000|Metric Ton|Month
  • Storage:Store in sealed containers at cool & dry place. Protect from light, moisture and pest infestation.
  • Transportation:By DHL, TNT, FedEx, HKEMS, UPS, Etc

Superiority:

1. Guaranteed purity;

2. Large quantity in stock;

3. Largest manufacturer;

4. Best service after shipment with email;

 

5. High quality & competitive price;

 

Details:

high quality  141758-74-9  Exendin-4   with best price
 
Exendin-4 Basic information
New diabetes drugs Uses
Product Name: Exendin-4
Synonyms: EXENDIN-4;M.W. 4186.61 C184H282N50O60S;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4)
CAS: 141758-74-9
MF: C184H282N50O60S
MW: 4186.57188
EINECS: 686-356-3
Product Categories: Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;-;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors
Mol File: 141758-74-9.mol
Exendin-4 Structure
 
Exendin-4 Chemical Properties
RTECS  VT9545000
storage temp.  −20°C
 
Safety Information
WGK Germany  3

  

Advantages:
 

Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best service is our philosophy. We have Flexible and Untraceable payment terms. As a leading manufacture, our products have been exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Brazil, Mexico, Australia, Japan, Korea, Thailand, Indonesia, Uruguay and many other countries.
 
1. Quality.Every batch of steroid powders have tobetested by our QC(quality control) before they are allowed to sell.
 
2. Delivery We have stock, so we can delivery quickly at the very day when receive the payment. Within 24 hours after receiving the payment Lead time 4 or 7 days.
 
3. Discreet package Safelyand Professionally Disguised Package Guaranteed. For your safety and to insure delivery all products will be packed in a discreet way to prevent any suspicions, no steroids related name will appear on the parcels. high successful delivery rate.
 
4. Warm after-sale service Any of your question would be solved for the first as soon as possible.

 

 

 

high quality  141758-74-9  Exendin-4   with best price

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View