high quality 16941-...

high quality 16941-32-5 Glucagon with best price

high quality 16941-32-5 Glucagon with best price

Min.Order / FOB Price:Get Latest Price

10 Gram

Negotiable

  • Min.Order :10 Gram
  • Purity: 99%
  • Payment Terms : T/T,

Keywords

Glucagon 16941-32-5 16941-32-5 Glucagon

Quick Details

  • Appearance:White Crystalline Powder
  • Application: It Can Be Used As Pharmaceutical Intermediates Etc
  • PackAge:100g/ bag, 2 kg/ bag, 25kg/ carton or as required
  • ProductionCapacity:1000|Metric Ton|Month
  • Storage:Store in sealed containers at cool & dry place. Protect from light, moisture and pest infestation.
  • Transportation:By DHL, TNT, FedEx, HKEMS, UPS, Etc

Superiority:

1. Guaranteed purity;

2. Large quantity in stock;

3. Largest manufacturer;

4. Best service after shipment with email;

 

5. High quality & competitive price;

 

Details:

high quality 16941-32-5  Glucagon   with best price
 
Glucagon Basic information
Polypeptide hormone with straight-chain Pharmacological effects Indications Usage and dosage Side effects
Product Name: Glucagon
Synonyms: GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS: 16941-32-5
MF: C153H225N43O49S
MW: 3482.75
EINECS: 685-611-6
Product Categories: Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;-;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Mol File: 16941-32-5.mol
Glucagon Structure
 
Glucagon Chemical Properties
storage temp.  −20°C
solubility  Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form  powder
 
Safety Information
WGK Germany  3
F  3-10-21

  

Advantages:
 
Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best service is our philosophy. We have Flexible and Untraceable payment terms. As a leading manufacture, our products have been exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Brazil, Mexico, Australia, Japan, Korea, Thailand, Indonesia, Uruguay and many other countries.
 
1. Quality.Every batch of steroid powders have tobetested by our QC(quality control) before they are allowed to sell.
 
2. Delivery We have stock, so we can delivery quickly at the very day when receive the payment. Within 24 hours after receiving the payment Lead time 4 or 7 days.
 
3. Discreet package Safelyand Professionally Disguised Package Guaranteed. For your safety and to insure delivery all products will be packed in a discreet way to prevent any suspicions, no steroids related name will appear on the parcels. high successful delivery rate.
 
4. Warm after-sale service Any of your question would be solved for the first as soon as possible.

 

 

 

high quality 16941-32-5  Glucagon   with best price

View All
Visit Store

You Might Also Like

Related Searches

Contact Supplier

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View