Min.Order / FOB Price:Get Latest Price
10 Gram |
Negotiable |
Glucagon 16941-32-5 16941-32-5 Glucagon
4. Best service after shipment with email;
5. High quality & competitive price;
Glucagon Basic information |
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 685-611-6 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;-;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research |
Mol File: | 16941-32-5.mol |
Glucagon Chemical Properties |
storage temp. | −20°C |
solubility | Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides. |
form | powder |
Safety Information |
WGK Germany | 3 |
F | 3-10-21 |
Advantages:
Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best service is our philosophy. We have Flexible and Untraceable payment terms. As a leading manufacture, our products have been exported to Germany, Norway, Poland, Finland, Spain, UK, France, Russia, USA, Brazil, Mexico, Australia, Japan, Korea, Thailand, Indonesia, Uruguay and many other countries.
1. Quality.Every batch of steroid powders have tobetested by our QC(quality control) before they are allowed to sell.
2. Delivery We have stock, so we can delivery quickly at the very day when receive the payment. Within 24 hours after receiving the payment Lead time 4 or 7 days.
3. Discreet package Safelyand Professionally Disguised Package Guaranteed. For your safety and to insure delivery all products will be packed in a discreet way to prevent any suspicions, no steroids related name will appear on the parcels. high successful delivery rate.
4. Warm after-sale service Any of your question would be solved for the first as soon as possible.
high quality 16941-32-5 Glucagon with best price
CAS NO:23111-00-4
CAS NO:58-85-5
CAS NO:73-31-4
CAS NO:96829-58-2
CAS NO:50-28-2
CAS NO:171596-29-5
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View