- Min.Order :10 Gram
- Purity: 98%
- Payment Terms : L/C,D/A,D/P,T/T,
Keywords
CJC1294 with DAC base powder CJC1294 with DAC base raw powder CJC1294 with DAC base ?Injection
Quick Details
- Appearance:White to off white powder
- Application: can be used as pharmaceutical material...
- PackAge:Icebag, Discreet Packing ways for your choice.
- ProductionCapacity:1000|Gram|Day
- Storage:Store in a cool dry place and keep away from direct strong light
- Transportation:EMS, DHL, FedEx, UPS
Superiority:
Superiority
1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from our customers. We had Established long friendly relations of cooperation.
2.High quality, best price, firstclass service, high successful delivery rate.
3.We have stock, so we can delivery quickly at the very day when receive the payment.
4.We will never sell, solicit,or give your information to any third parties. All transactions are confidential.Your satisfaction is guaranteed,as long as you have dissatisfaction,we will show our biggest sincerity and patience to solve problems.
5.We have the special way can ship 50 grams to 50kg products at a time. We can offer the melting powder into liquid service.And ship the liquid in the special bottles. According to your request and the quantity what you buy, we have several packaging methods for your choice. safety and quick shipping to you.
6.We can do ,TT and Money Gram wire transfer payment term.
Details:
Product Description
| Product Name: | CJC1295 |
| Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC |
| CAS: | 863288-34-0 |
CJC1295 is a tetrasubstituted peptide of 29 amino acid length, primarily functioning as a releasing hormone (GHRH) analog. It was invented by a Canadian biotechnology company. CJC1295 is a synthetic human GHRH analog that binds to endogenous albumin after subcutaneous administration, extending its half-life and therapeutic window. CJC1295 has been reported to increase plasma concentations by 2-10X for more than 7 days and increased concentrations for up to 28 days.
.Competitive Advantage:
1.High quality with competitive price:
2.Standard: Enterprise Standard
3.All Purity≥99%
4.We are manufacturer and can provide high quality products with factory price
5. Service: Reply quickly ,Tracking number ,Status updates ,Receiving remind ,Good after-sales service.
You Might Also Like
-
Good Quality for 99% Purity GMP Certified CAS 71447-49-9 Gonadorelin Acetate(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
High Purity for 99% Purity Gonadorelin, Gonadorelin Acetate, Peptide, 71447-49-9(33515-09-2)(33515-09-2)
CAS NO:33515-09-2
-
Quality for 99% Purity Pharmaceutical Peptide Epitalon Product From China(307297-39-8)
CAS NO:307297-39-8
-
Quality for 99% Purity High Quality CAS 141732-76-5 Exenatide Acetate Peptide(141732-76-5)
CAS NO:141732-76-5
-
Quality for 99% Purity Felypressin Acetate /56-59-7 / C46h65n13o11s2 Peptide(56-59-7)
CAS NO:56-59-7
-
Quality for 99% Purity Pharmaceutical Peptide Selank Powder 99% Purity Anxiolytic CAS: 129954-34-3(129954-34-3)
CAS NO:129954-34-3
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View