Corticotropin (ACTH...

Corticotropin (ACTH (1-39) (human))

Corticotropin (ACTH (1-39) (human))

Min.Order / FOB Price:Get Latest Price

1 Milligram

Negotiable

  • Min.Order :1 Milligram
  • Purity: 95%;98%;99%
  • Payment Terms : T/T

Keywords

Corticotropin (ACTH (1-39) (human)) 12279-41-3 SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Quick Details

  • Appearance:Whithe powder
  • Application:Research
  • PackAge:According customer's requirements
  • ProductionCapacity:1-1000|Gram|Day
  • Storage:keep in dry,cool
  • Transportation:According customer's requirements

Superiority:

Apeptide Co.,Ltd  (Shanghai ,China) is one of famous-peptide manufacturers in China.
For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc...
Our website address:   www.apeptides.com/en/
We have amyloid peptides libs and supply high quality\competetive price\best service.
 
We Supply :
Peptide   
Custom pepitdes synthesis
Amino acids/Unusual amino acids
Custom amino acid synthesis
Protein expression
 
We can do:
Custom Peptide Modifications
         o Amidation,C-termainal
         o Aldehydes,C-termainal
         o Alcohols,C-termainal
         o pNA (p-Nitroanilide),C-termainal
         o AMC,C-termainal
         o AFC,C-termainal
         o Cysteamide,C-termainal
         o Ester,C-termainal
         o N-Alkyl Amides,N-termainal  
         o Acetylated,N-termainal 
         o Palmytolyl,N-termainal 
         o HYNIC,N-termainal 
         o Biotinylated,N-termainal 
         o Bromoacetylated,N-termainal 
         o DOTA,DTPA conjugated,N-termainal 
         o Formylated,N-termainal 
         o Myristoylated,N-termainal 
         o Succinylated,N-termainal 
 Dye-labeled peptides
       AFC, AMC, Lys(Dye), pNA, Rh110 
 N-terminal Modifications
       Bodipy-FL, Cy3, Cy5, Texas Red, 5-Tamra, 5-lodoacetamido fluorescein
       Rhodamine 110 and Rhodamine B Luciferin, EDANS
       FAM, FITC, MCA, Rox, Sulforhodamine 101, 5-TAMRA  
Cyclic peptides
        o N -> C or Head to Tail o Disulfide (S-S bond formation) .Trisulfide formation)
        o Cyclic-natural peptides 
 Methylated peptides
        o Lys(For),Lys(Me), Lys(Me)2, Lys(Me)3, Arg(Me)2 symmetrical, D-Tyr(Me),D-Tyr(Et)
        o Na-Methylated(N-Me-Arg,N-Me-Asp, N-Me-Glu, N-Me-Leu, N-Me-Nle, N-Me-Nva, N-Me-Phe, N-Me-S N-Me-Ser, N-Me-Trp, N-Me-Thr, N-Me-Val)
Other modifications
       o BSA, KLH conjugated peptides for antibody production )
       o Phosphoserine, Phosphothreonine, Phosphotyrosine
       o Sulfated Tyrosine or Serine
       o MAPS (Multiple Antigenic Peptide) 
       o Glycopeptides
       o PEGylation
       o Peptidomimetics
 
 
 
 

Details:

We also supply 
Amino Acid Derivatives
Peptide Synthesis Services
Express Peptide Synthesis
Peptide Library Services
Peptide Array Services 
Catalog peptides  as below:
 
Adipokinetic Hormones (AKH) Peptides
Adrenocorticotropic Hormone (ACTH) and Sequences Peptides
Adrenomedullins Peptides
Agonists Peptides
Allatostatins Peptides
Amylins and Fragments Peptides
Amyloid Peptides :Amyloid P Component Peptides
Amyloid Peptides :Amyloid β/A4 Protein Precursor (APP) Fragments 
Amyloid Peptides :Amyloid β-Protein Fragments - Alzheimer's Disease β-Protein Fragments 
Amyloid Peptides :Non-Aβ Component of Alzheimer's Disease Amyloid Peptides
Angiogenin Fragments Peptides
Angiotensin Converting Enzyme (ACE) Substrates, Inhibitors and Bradykinin Potentiator Peptides 
Angiotensins and Related Peptides 
Antagonists  Peptides
Anthopleura Neuropeptides 
Anti-HIV Peptides 
Anti-Inflammatory Peptides 
Anti-Microbial Peptides 
Antioxidant Peptides 
Atrial Natriuretic Peptides (ANP/ANF) and Related Peptides
Autoimmune Antigenic Epitope Peptides for Systemic Lupus Erythematosus 
Bag Cell Peptides 
BAM (Bovine Adrenal Medulla) Peptides
Band 3 Protein Fragments 
Biotinylated Peptides 
Bombesin and Analogs Peptides
Bradykinin Potentiator Peptides (BPP) 
Bradykinins and Analogs Peptides
Brain Derived Fibroblast Growth Factor (FGF) Fragments - See Fibroblast Growth Factor (FGF) Fragments 
Brain Natriuretic Peptides (BNP)
C3a and C3d Peptides 
Caerulein and Analogs Peptides
Calcitonin and Calcitonin Precursor Peptides
Calcitonin Gene Related Peptide (CGRP) and Fragments Peptides
Cardioactive Peptides
Casein Kinase Substrates Peptides
Caspase-1 Substrates – see ICE Substrates  Peptides
Cathepsin G Peptides 
CD4 Peptide Fragments - see HIV Peptides 
Cecropins Peptides
Ceratotoxins Peptides
Cerebellin and Analog Peptides
Chemotactic Peptides
Cholecystokinin (CCK)-Pancreozymin and Related Peptides 
Circumsporozoite (CS) Protein Repetitive Sequences 
Circumsporozoite (CS) Protein Sequence 
CKS-17 and Fragment Peptides
Cocaine- and Amphetamine-Regulated Transcript (CART)
Conantokin G, T and Analogs Peptides
Conopressins and Analogs Peptides 
Conotoxins Peptides
Corticotropin-Releasing Factor (CRF) and Analogs Peptides 
C-Peptides
CPF Peptides - See HIV Peptides
C-Reactive Protein (CRP) Sequences Peptides 
C-Type Natriuretic Peptide (CNP) 
Cytomegalovirus (CMV) Peptides 
Delta Sleep Inducing Peptide (DSIP) and Analogs Peptides
Deltorphins, Dermorphins and Analogs Peptides
Diazepam Binding Inhibitor (DBI) Fragments Peptides
Dynorphin, Analogs and Precursors Peptides
Eglin c Fragments Peptides
Endorphins, Analogs and Fragments  Peptides
Endothelin Receptor Antagonists Peptides
Endothelins and Related Peptides
Enkephalinase Inhibitors Peptides
Enkephalins and Related Peptides
Enterostatins  Peptides
Exendins and Fragment
Experimental Allergic Encephalomyelitis (EAE) Related Peptides
Fibrinogen and Related peptides
Fibrinopeptides 
Fibroblast Growth Factor (FGF) Inhibitory Peptides
Fibroblast Growth Factors (FGF), Fragments
Fibronectin Fragments and Fibrin Related Peptides
FMRF-amide and Analogs  Peptides
Galanin Message Associated Peptide (GMAP) Fragments
Galanins and Related Peptides
GAP (see Gn-RH Associated Peptides) 
Gastric Inhibitory Peptides (GIP)
Gastrin and Related Peptides
Gastrin Releasing Peptide (GRP) and Related Peptides 
Glucagons and Related Peptides
Gluten Exorphins Peptides
Gonadotropin Releasing Hormone (GnRH) Associated Peptides (GAP)
Gonadotropin Releasing Hormones (GnRH) - see Luteinizing Hormone-Releasing Hormones 
Granulocyte-macrophage-colony stimulating factor (GM-CSF) Inhibitory Peptides 
Growth Factors and Related Peptides 
Growth Hormone Releasing Factors (GRF)
Growth Hormone-Release Inhibiting Factors (GIF) - see Somatostatins 
GTP-Binding Protein Fragments 
HCV Core Protein Sequences 
HCV Envelope 2 Protein Fragments 
HCV NS3 Protease Substrates and Cleavage Products
HCV NS4A Protein Fragments 
Helospectins Peptides
Hepatitis C Virus (HCV) Peptides 
Herpes Simplex Virus (HSV) Peptides
Hirudin Fragments and Analog
Histatins  Peptides
Histocompatibility Antigens 
HIV Integrase (IN) Inhibitor 
HIV Peptides 
HIV Protease Substrates 
HIV Protein p24 Fragments 
HIV(gp120) and (gp41) Fragments and Related Peptides
HIV-1 rev and Fragment Peptides
Hydra Peptide and Analogs  Peptides
Hydrins  Peptides
Hylambatins Peptides
Hypercalcemia of Malignancy Factor Sequences - see Parathyroid Hormone (PTH)-Related Protein Sequences 
Hypertrehaloseamic Peptides
ICE (Caspase-1) Substrates
IL Receptor Antagonists  Peptides
Insulin-Like Growth Factors (IGF), Fragments and Related Peptides 
Interleukins, Fragments and Related Peptides 
Kassinins Peptides
Kinetensin and Fragment  Peptides
Kyotorphins  Peptides
Laminin Fragments 
Leptin Fragments 
Leucokinins  Peptides
Leucopyrokinin (LPK) and Fragment 
Leumorphins  Peptides
Luteinizing Hormone-Releasing Hormone (LHRH) and Analogs (Gonadotrophin Releasing Hormone (GnRH) and Analogs) 
Lymphokine Related Peptides 
Magainins  Peptides
MAGE Antigen Fragments – see melanoma peptides 
Malaria Peptides – see Circumsporozoite (CS) Sequences 
Mast Cell Degranulating (MCD) Peptides
Mastoparans Peptides
Mating Factors (Yeast) Peptides
Melanin-Concentrating Hormones (MCH)Peptides
Melanocyte Stimulating Hormones (MSH) and Related Peptides 
Melanoma Peptides 
Melanotropin Potentiating Factor (MPF) and Analog 
Metamorphosin A and analog Peptides
Morphiceptins and Analogs  Peptides
Morphine Modulating Neuropeptides 
Motilins Peptides
Murine CMV pp89 Fragments - See Cytomegalovirus Peptides 
Myelin Basic Protein Fragments 
Neoendorphins Peptides
Neurokinins  Peptides
Neurokinins, Neuromedins and Related Peptides 
Neuromedins  Peptides
Neuropeptide Y (NPY) and Related Peptides 
Neuropeptides  Peptides
Neurotensin, Analogs and Fragments - see also Kinetensin and Fragment 
Neurotoxins - see Agatoxin, Agelenin, Anthopleura neuropeptides, Apamin, Charybdotoxin, Conantokins,Conopressins, Conotoxins, Dendrotoxin, Iberiotoxin, Kaliotoxin, Leiurotoxin, Margatoxin, Mast Cell Degranulating Peptides, Mastoparans, Noxiustoxin, Sarafotoxins, Scyllatoxin, Stichodactyla helianthus Neurotoxins, Tityustoxin 
Nociceptin and Fragment  Peptides
N-Ureido Chemotactic Peptides 
Obesity Gene Peptides - see Leptin Fragments 
Octadecaneuropeptide (ODN) - see Diazepam Binding Inhibitor Fragments 
Osteocalcin, Analogs and Fragments
Ovalbumin (OVA)  Peptides
Oxytocin and Analogs Peptides
PACAP - see Pituitary Adenylate Cyclase Activating Polypeptide and Related Peptide 
Pancreastatin, Analogs and Fragments 
Pancreatic Polypeptides
Parathyroid Hormone (pTH), Analogs and Fragments
Peptide T  Peptides
Peptide YY (PYY) and Related Peptides 
PHI - see Vasoactive Intestinal Peptides (VIP/PHI)
Physalaemin and Fragments 
Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) and Related Peptides 
Platelet Factor 4 Fragments 
Platelet-Derived Growth Factors (PDGF) and Related Peptides
Pneumadins  Peptides
Protein Kinase Related Peptides 
PYY - see Peptide YY and Related Peptides 
Ras Oncogene Related Peptides 
Receptor-Specific Enkephalins
Renin Inhibitors  Peptides
Renin Substrates  Peptides
RGD Peptides – see Fibronectin Fragments and Fibrin Related Peptides 
Sarafotoxins  Peptides
Scyliorhinins Peptides
Secretins  Peptides
Sequences derived from Leu-Enkephalin
Sequences derived from Met-Enkephalin
SIV (gp140) Fragment
Somatostatin and Analogs -Growth Hormone-Release Inhibiting Factors (GIF)
Spantides  Peptides
Sperm-Activating Peptides (SAP) 
Src Homology-2 (SH2) Domain Ligands 
Substance P Antagonists
Substance P, Analogs and Fragments 
Thrombin Receptor-Derived Peptides 
Thymopoietin (TP) Fragments 
Thymosins  Peptides
Thyrotropin-Releasing Hormone (TRH), Analogs and Related Peptides 
Transforming Growth Factors (TGF) and Fragments 
Tumor Necrosis Factors (TNF) and Fragments
Tyrosine Kinase Substrates – see Protein Kinase Related Peptides 
Urechistachykinins  Peptides
Urocortins  Peptides
Urotensin  Peptides
Valorphin and Related Peptide 
Vasoactive Intestinal Peptide (VIP) and Related Peptides 
Vasotocin and Analogs 
Xenopsin and Xenopsin-Related Peptides
β-Casomorphin, Analogs and Fragments
β-Lipotropins  Peptides
 
If you need other peptides or need custom peptide synthesis , Please contact us
 
***  All of  products we supply just for Lab research use only, Not directly for Human use.
 

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View