Min.Order / FOB Price:Get Latest Price
100 Gram |
Negotiable |
Nesiritide acetate Nesiritide acetate low price 114471-18-0
Product Name: Nesiritide acetate
Synonyms: BNP-32;BNP-32 (HUMAN);BNP (1-32), HUMAN;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26);NESIRITIDE ACETATE;SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26)
CAS: 114471-18-0
MF: C143H244N50O42S4
MW: 3464.04
EINECS:
Product Categories: Amino Acid Derivatives;Peptide;-;SignalTransduction
Mol File: 114471-18-0.mol
Uses hemostatic, antimicrobial
Wuhan Zenuo Biopharmaceutical Technology Co., Ltd., a global biopharmaceutical and chemical enterprise, is mainly engaged in the customized synthesis, large-scale production and sales of pharmaceutical raw materials intermediates, mainstream fine chemicals, rare chemical raw materials. Zenuo is located in the Guanggu Biological Industry Zone in Wuhan, Hubei Province, attributing to a number of senior professionals with years of experience, in-depth cooperation is conducted with laboratories of domestic first-class colleges and universities, which ensures Zenuo standing at the forefront of the international level. Zenuo can provide global customers with quality products and the best price, meanwhile, Zenue embraces customized synthesis of chemical products from trial sample to mass production, synthetic formulation, process upgrading,etc... At present, Zenuo’s stable supply of products includes: kojic acid, Dyclonine hydrochloride, hydrocortisone, dexamethasone, betamethasone and other steroid hormone raw materials and intermediates products. Zenuo guarantees long-term and stable supply of the mentioned products.
Strict quality control: good raw materials, good quality, Zenuo Biology has always regarded quality as the life of the enterprise. Zenuo Biology has an independent quality control department and long-term cooperation with the third-party detection structure. All products are strictly tested in accordance with Pharmacopoeia and relevant regulations to ensure that the quality is up to standard.
Advantage price service: The company produces and sells one-stop service. The price of the product is very advantageous. At the same time, our experienced technical team constantly improves and innovates, reduces costs and ensures the quality of the product.
Purchasing Agent Service: Professional team can provide you with timely and thoughtful service, good language communication skills and professional chemical technical consultants, can answer customers'professional academic questions. Our goal is to provide qualified products with reasonable prices for global customers, wholeheartedly provide purchasing agent service to customers, help shorten the procurement time and reduce the procurement cost.
Over the years, our products and services have been exported to the United States, Europe, Africa, Southeast Asia, the Middle East and other countries and regions, and have established long-term stable business relations with customers.
CAS NO:49557-75-7
CAS NO:147732-56-7
CAS NO:72957-37-0
CAS NO:868844-74-0
CAS NO:214047-00-4
CAS NO:959610-30-1
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View