Longevity Peptide FOXO4-DRI Purity 98% FOXO4 D-Retro-Inverso 5mg vials Free Shipping

Min.Order / FOB Price:Get Latest Price

1 Gram	FOB Price:USD 5.0000 -10.0000

1 Gram

FOB Price:USD 5.0000 -10.0000

Min.Order :1 Gram
Purity: 98%
Payment Terms : L/C,T/T,

Keywords

FOXO4 DRI FOXO4 Proxofim

Quick Details

Appearance:White Lyophilized Powder
Application:Longevity research, anti aging research
PackAge:Bottle or Vials
ProductionCapacity:5|Gram|Month
Storage:Common storage 2-8℃, long time storage -20℃.
Transportation:By air

Superiority:

Details:

Product Name :FOXO4 DRI peptide

Sequence：H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Three letter code

H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH

Length (aa): 46

Peptide Purity (HPLC) :98.0% Min

Molecular Formula :C228H388N86O64

Molecular Weight :5358.05

Source : Synthetic

Quality:See COA,MS,HPLC,MSDS reports

Specifications: 5mg vials, 10mg vials

Storage :

Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution.

Min order :5 vials

Shipping: By Express DHL or FEDEX

View All

Visit Store