High purity CAS 570...

High purity CAS 57014-02-5 Calcitonin eel
High purity CAS 57014-02-5 Calcitonin eel
High purity CAS 57014-02-5 Calcitonin eel
High purity CAS 57014-02-5 Calcitonin eel
High purity CAS 57014-02-5 Calcitonin eel

High purity CAS 57014-02-5 Calcitonin eel

Min.Order / FOB Price:Get Latest Price

1 Gram

FOB Price: USD 100.0000

  • Min.Order :1 Gram
  • Purity: 99%
  • Payment Terms : L/C,T/T

Keywords

57014-02-5 Calcitonin eel C146H241N43O47S2

Quick Details

  • Appearance:White powder
  • Application:API,Pharmaceutical intermediates
  • PackAge:25KGS/Drum
  • ProductionCapacity:1000|Metric Ton|Day
  • Storage:Room temperature
  • Transportation:BY SEA

Superiority:

High purity CAS 131-54-4 2,2'-Dihydroxy-4,4'-dimethoxybenzophenone in stock

Our main business covers the fields below:
 
1.Noble Metal Catalysts (Pt.Pd...)
2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)
3.OLED intermediates (Fluorene,Carbazole,Boric acid...)
4.Pharmaceutical intermediates 
 
 About us
1.More than 10 years chemical exporting experience 
We have produced chemical more than fifteen years., 80% products are for export .
More than 10 years chemical exporting experience. Good and stabilized factory price.
2.Strict quality control system
3.Supply sample
Before order , we can send the sample for your testing . We ensure the quality is the same as bulk quantity .
 
 Our advantage:
Q1:Can I get the free sample
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.
Payment by T/T, or Paypal or L/C.
 
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ
A:Usually according you demand.
 
Q5: How about delivery leadtime
A:Delivery lead time: As soon as possible. (Chinese holiday not included)
 
Q6:Is there a discount
A:Different quantity has different discount.
 
Q7: How to contact us
A:You can chat with us by Trademanager,Email,WhatsAPP,Wechat.
You can choose your interested products and send inquiry to us.
You can dial our telephone directly, you will get our reply.

Details:

Calcitonin eel Basic information
Product Name: Calcitonin eel
Synonyms: THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
CAS: 57014-02-5
MF: C146H241N43O47S2
MW: 3414.87
EINECS: 232-693-2
Product Categories: TPI;Peptide
Mol File: 57014-02-5.mol
 
Packing:
About us
1.More than 10 years chemical exporting experience 
We have produced chemical more than fifteen years., 80% products are for export .
More than 10 years chemical exporting experience. Good and stabilized factory price.
2.Strict quality control system
3.Supply sample
Before order , we can send the sample for your testing . We ensure the quality is the same as bulk quantity .
 
Delivery:
 
 Our advantage:
Q1:Can I get the free sample
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.
Payment by T/T, or Paypal or L/C.
 
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ
A:Usually according you demand.
 
Q5: How about delivery leadtime
A:Delivery lead time: As soon as possible. (Chinese holiday not included)
 
Q6:Is there a discount
A:Different quantity has different discount.
 
Q7: How to contact us
A:You can chat with us by Trademanager,Email,WhatsAPP,Wechat.
You can choose your interested products and send inquiry to us.
You can dial our telephone directly, you will get our reply.
 
Our Factory
 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View