Peptide CJC-1295 w...

Peptide  CJC-1295 without DAC  CAS : 863288-34-0
Peptide  CJC-1295 without DAC  CAS : 863288-34-0
Peptide  CJC-1295 without DAC  CAS : 863288-34-0
Peptide  CJC-1295 without DAC  CAS : 863288-34-0
Peptide  CJC-1295 without DAC  CAS : 863288-34-0

Peptide CJC-1295 without DAC CAS : 863288-34-0

Min.Order / FOB Price:Get Latest Price

1 Kilogram

FOB Price:USD 3.0000 -10.0000

  • Min.Order :1 Kilogram
  • Purity: >99%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

Bodybuilding Lyophilized Powder Peptide CJC-1295 without DAC Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2

Quick Details

  • Appearance:White or nearly white crystalline powder.
  • Application:Mainly used to release analogues
  • PackAge:Inside plastic outside
  • ProductionCapacity:300|Metric Ton|Week
  • Storage:Somewhere cool and dry
  • Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 10g to 1000kg or even bulker

Superiority:

With our good experience, we offer detailed technical support and advice to assist customers. We communicate closely with customers to establish their quality requirements.

Consistent Quality
Our plant has strict quality control in each manufacturing process. Guaranteed.
Meanwhile all the materials are tested before each shipment in our laboratory to double confirm the quality.

Most competitive pricing
Our company is committed to the production and development of titanium dioxide, we always offer the most competitive pricing to customers to help lower their cost in application.

Shortest delivery time
90% of orders are shipped within 7-10 days after receipt of the prepayment or workable L/C.

Respond in 24 hours to inquiry, feedback or other requirements
Our experienced staff is dedicated to answer all of your inquires, feedback or other requirements in 24 hours.

We welcome you to contact us for more information and look forward to working with yo

Details:

Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 

2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials

Product Introduction  

Product name CJC' 1295 dac
CAS No. 863288-34-0
Other Names CJC' 1295
Molecular Formula C152H252N44O42
Molecular weight 3367.89688
Grade Standard Medicine Grade
COA Avaliable
Appearance White or almost white crystalline powder.
Purity 99%min
Density 1.4±0.1 g/cm3
Refractive index 1.644
PSA 1513.38
LogP -2.88
Storage condition 2-8ºC
Shelf life 2 years

 

Product Usage

CJC' 1295 DAC is a tetrasubstituted 30-amino acid peptide, primarily functioning as a releasing analog.One of the advantages of CJC' 1295 over traditional is its ability to bioconjugate with serum albumi, thus increasing its half-life and therapeutic window.It accomplishes this by using protecting groups around the amino acids of ' typically susceptible to enzymatic degradation. 

Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,  

Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.  

Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization,  Keep moving!  

Packing:  
  1. Inner double plastic bags----25kg/Fiber drum (35*35*45cm, GW: 28kg, NW: 25kg); 

  2. Inner double plastic bags----5kg/Aluminum foil bag (GW: 6.5kg, NW: 5kg). 

  3. Inner double plastic bags----1kg/Aluminum foil bag (GW: 1.5kg, NW: 1kg). 

P.S.: we accept packaging customization. 
  
Delivery:   

  1. Stock products are normally shipping within 3 working days.  

  2. For rush delivery, please contact our sales team for particular arrangement. 

Shipping Details: 
  1. We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 10g to 1000kg or even bulker. 

  2. Shipping details & shipping documents will be provided and sent by email. 

  3. We keep tracking the shippment until clients well received. 

  4. After years export shipping experience, with professional and experienced cooperated forwarders, we ensure that goods can be delivered in multiple ways safetly and efficiently. 

FAQ: 
1. Are you a trade company or factory   
We are a  factory with our own trading company.  

  1. How do you control the quality   
    Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.   
  2.  How long is lead time   
    We deliver goods within 3 days for small order, 7-10 days for bulk order.   
  3.  Where is your factory located  How can I visit the factory   
     Our factory located in WEIFANG, China. It is only two hours from QINGDAO.  


6. Can i get some samples  
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 


7. How to start orders or make payments  
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  


8. How to confirm the Product Quality before placing orders  
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
  You can send us your product specifications and requests,we will manufacture the products according to your requests. 

9. How long is lead time

We deliver goods within 3 days for small order, 7-10 days for bulk order.

 

10. How do you treat quality complaint

  First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View