GALANIN, RAT CAS114547-31-8

Min.Order / FOB Price:Get Latest Price

1 Kilogram	FOB Price:USD 7.0000 -9.0000

1 Kilogram

FOB Price:USD 7.0000 -9.0000

Min.Order :1 Kilogram
Purity: 98%
Payment Terms : T/T,MoneyGram,Other

Keywords

GALANIN, RAT GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2 GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Quick Details

Appearance:White powder
Application:For scientific research
PackAge:fiber can
ProductionCapacity:100|Metric Ton|Month
Storage:Seal and store in a cool and dry place
Transportation:By sea/air/land

Superiority:

1. Product advantages

♦ High purity, all above 98.5%, no impurities after dissolution

♦ We will test each batch to ensure quality

♦ OEM and private brand services designed for free

♦ Various cap colors available

♦ We can also provide MT1 peptide powder

2. Factory advantages

♦ Professional research team

♦ More than 5 doctors in high-tech R&D laboratories

♦ More than 1000 m2 of factory production line to ensure stable supply

♦ More than 1200 factories to manufacture products and control quality

3. Service advantages

♦ 24-hour online service

♦ Track package information and update it for customers

♦ Professional sales team

♦ Accept small order service

♦ Redelivery service if detained by customs

Details:

Molecular formula C141H211N43O41
Molecular weight 3164.45,000
Accurate mass 3162.57000
PSA 1347.03000
Appearance properties white freeze-dried powder

Package

Delivery

Our company has long-term cooperation with many world-famous logistics companies to ensure transportation efficiency and cargo safety.

By Express	By air	By Sea
Suitable for under 50kg Fast: 3-7 days High cost Door to door service, easy to pick up the goods	Suitable for more than 50kg Fast: 3-7 days High cost Port to port, professional broker needed	Suitable for more than 500kg Slow: 7-45 days Low cost Port to port, professional broker needed

View All

Visit Store

GALANIN, RAT CAS114...