Calcitonin CAS9007-...

Calcitonin CAS9007-12-9
Calcitonin CAS9007-12-9
Calcitonin CAS9007-12-9
Calcitonin CAS9007-12-9
Calcitonin CAS9007-12-9

Calcitonin CAS9007-12-9

Min.Order / FOB Price:Get Latest Price

1 Kilogram

FOB Price:USD 289.0000 -499.0000

  • Min.Order :1 Kilogram
  • Purity: 98%
  • Payment Terms : T/T,Other

Keywords

Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7) Chemical

Quick Details

  • Appearance:White powder
  • Application:The main effect of calcitonin is to reduce blood calcium through the regulation of bone, gastrointestinal tract and kidney.
  • PackAge:fiber can
  • ProductionCapacity:100|Metric Ton|Month
  • Storage:Seal and store in a cool and dry place
  • Transportation:By sea/air/land

Superiority:

1. Product advantages

♦ High purity, all above 98.5%, no impurities after dissolution

♦ We will test each batch to ensure quality

♦ OEM and private brand services designed for free

♦ Various cap colors available

♦ We can also provide MT1 peptide powder

2. Factory advantages

♦ Professional research team

♦ More than 5 doctors in high-tech R&D laboratories

♦ More than 1000 m2 of factory production line to ensure stable supply

♦ More than 1200 factories to manufacture products and control quality

3. Service advantages

♦ 24-hour online service

♦ Track package information and update it for customers

♦ Professional sales team

♦ Accept small order service

♦ Redelivery service if detained by customs

Details:

physicochemical properties

molecular formula C145H240N44O48S2
molecular weight 3431.85000
Precise quality 3429.71000
PSA 1558.81000
Appearance traits powder
Storage conditions −20°C
Water solubility 0.05 M acetic acid: 1 mg/mL, clear, colorless

 

Package

 

Delivery

Our company has long-term cooperation with many world-famous logistics companies to ensure transportation efficiency and cargo safety.

 

 

 

 

 

By Express

By air

By Sea

Suitable for under 50kg
Fast: 3-7 days
High cost
Door to door service,
easy to pick up the goods

Suitable for more than 50kg
Fast: 3-7 days
High cost
Port to port,
professional broker needed

Suitable for more than 500kg
Slow: 7-45 days
Low cost
Port to port,
professional broker needed

 

FAQ

1. Are you a trade company or factory   
We are a  factory with our own trading company.  

2. How long is lead time  
We deliver goods within 3 days for small order, 7-10 days for bulk order.   

3. Where is your factory located How can I visit the factory   
 Our factory located in WEIFANG, China. It is only two hours from QINGDAO.  

4. Can i get some samples 
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 

5. How to start orders or make payments 
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  

6. How to confirm the Product Quality before placing orders 
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
  You can send us your product specifications and requests,we will manufacture the products according to your requests. 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View