Min.Order / FOB Price:Get Latest Price
1 Kilogram |
FOB Price:USD 289.0000 -499.0000 |
Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7) Chemical
1. Product advantages
♦ High purity, all above 98.5%, no impurities after dissolution
♦ We will test each batch to ensure quality
♦ OEM and private brand services designed for free
♦ Various cap colors available
♦ We can also provide MT1 peptide powder
2. Factory advantages
♦ Professional research team
♦ More than 5 doctors in high-tech R&D laboratories
♦ More than 1000 m2 of factory production line to ensure stable supply
♦ More than 1200 factories to manufacture products and control quality
3. Service advantages
♦ 24-hour online service
♦ Track package information and update it for customers
♦ Professional sales team
♦ Accept small order service
♦ Redelivery service if detained by customs
molecular formula | C145H240N44O48S2 |
---|---|
molecular weight | 3431.85000 |
Precise quality | 3429.71000 |
PSA | 1558.81000 |
Appearance traits | powder |
Storage conditions | −20°C |
Water solubility | 0.05 M acetic acid: 1 mg/mL, clear, colorless |
Package
Delivery
By Express |
By air |
By Sea |
Suitable for under 50kg |
Suitable for more than 50kg |
Suitable for more than 500kg |
FAQ
1. Are you a trade company or factory
We are a factory with our own trading company.
2. How long is lead time
We deliver goods within 3 days for small order, 7-10 days for bulk order.
3. Where is your factory located How can I visit the factory
Our factory located in WEIFANG, China. It is only two hours from QINGDAO.
4. Can i get some samples
Yes, we can supply free sample, but the shipping cost be paid by our customers.
5. How to start orders or make payments
Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,
6. How to confirm the Product Quality before placing orders
You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
CAS NO:27813-02-1
CAS NO:2113-05-5
CAS NO:57-85-2
CAS NO:49851-31-2
CAS NO:102-97-6
CAS NO:315-30-0
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View