1415456-99-3 CAS 1415456-99-3 Cagrilintide
Retatrutide CAS 2381089-83-2
Molecular Weight: 4409.01
Formula: C194H312N54O59S2
CAS: No.1415456-99-3
Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8) Sequence Shortening{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Storage: Please store the product under the recommended conditions in the Certificate of Analysis.
1. How is the quality
The qualities of most products are above 99% purity.
2. How is the package
Aluminum foil bag or as customer's required.
3. How is the storage
Keep in dry and cool place.
4. Through which service the package is deliveried
A door-to-door delivery, which means the package could be sent to the location specified by you.
5. Can I order sample to test
Yes, you are welcome to order sample before placing bulk order. We will send the sample directly to your door by courier.
WELCOME FOR INQUIRY AT ANY TIME. We believe that we are your trustworthy partner.
Company Introduction
Manhattan Technology Industry Co.,Ltd Mainly engaged in chemical products R & D and production, pharmaceutical intermediates R & D and production Chemical product development and customization, operating in one integrated high-tech enterprises. Unique ability in R&D and innovation of high precision chemicals.The company cooperates with a number of domestic pharmaceutical and chemical research institutes, forming a complete and unique new product technical force team.
To date, Manhattan has established cooperation with trading partners in more than 28 countries, including large buyers from Europe and the Americas. has been at the forefront of the industry. The company has strong technical force, advanced equipment, strict quality management system, quality after-sales service, adhere to the "customer first, forge ahead" business philosophy, adhere to the integrity of the company's survival. Everything for customer satisfaction, everything for the long-term healthy development of the enterprise.
Products Advantage
Products Photos
Package Photos
Factory & Lab
Shipping Details
Customer Service
Please contact us right now for all your quests and needs!
Whatsapp/Telegram/Wechat/Skype/Email/Phone, please choose the way you like.
We will be in response asap.
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View