Cagrilintide CAS 14...

Cagrilintide CAS 1415456-99-3
Cagrilintide CAS 1415456-99-3
Cagrilintide CAS 1415456-99-3

Cagrilintide CAS 1415456-99-3

Min.Order / FOB Price:Get Latest Price

1 Kilogram

Negotiable

  • Min.Order :1 Kilogram
  • Purity: 99%
  • Payment Terms : D/A,D/P,T/T,Other

Keywords

1415456-99-3 CAS 1415456-99-3 Cagrilintide

Quick Details

  • Appearance:powder
  • Application:Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist.
  • PackAge:bag
  • ProductionCapacity:500|Metric Ton|Month
  • Storage:Keep sealed
  • Transportation:AIR SHIPPING

Superiority:

Retatrutide CAS 2381089-83-2

Molecular Weight: 4409.01

Formula: C194H312N54O59S2

CAS: No.1415456-99-3

Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8) Sequence Shortening{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)

Storage: Please store the product under the recommended conditions in the Certificate of Analysis.

1. How is the quality
The qualities of most products are above 99% purity.

2. How is the package
Aluminum foil bag or as customer's required.

3. How is the storage
Keep in dry and cool place.

4. Through which service the package is deliveried

A door-to-door delivery, which means the package could be sent to the location specified by you.

5. Can I order sample to test
Yes, you are welcome to order sample before placing bulk order. We will send the sample directly to your door by courier.

WELCOME FOR INQUIRY AT ANY TIME. We believe that we are your trustworthy partner.

Details:

Company Introduction

Manhattan Technology Industry Co.,Ltd Mainly engaged in chemical products R & D and production, pharmaceutical intermediates R & D and production Chemical product development and customization, operating in one integrated high-tech enterprises. Unique ability in R&D and innovation of high precision chemicals.The company cooperates with a number of domestic pharmaceutical and chemical research institutes, forming a complete and unique new product technical force team.

To date, Manhattan has established cooperation with trading partners in more than 28 countries, including large buyers from Europe and the Americas. has been at the forefront of the industry. The company has strong technical force, advanced equipment, strict quality management system, quality after-sales service, adhere to the "customer first, forge ahead" business philosophy, adhere to the integrity of the company's survival. Everything for customer satisfaction, everything for the long-term healthy development of the enterprise.

 

Products Advantage

  • High Purity: More than 99%
  • In stock:  Top-sell products are always in stock.
  • Samples available: Suggest customer to test the sample before order.
  • Fast and safe shipping: 100% safe delivery to the USA, Mexico,Canada,Europe etc. free for all customs clearance. We will ship by special line that shipping company do custom clearance and deliver to your door, no customs issues! 100% safe delivery!

Products Photos

 

Package Photos

 

Factory & Lab

 

Shipping Details

 

 

Customer Service

Please contact us right now for all your quests and needs!

Whatsapp/Telegram/Wechat/Skype/Email/Phone, please choose the way you like.

We will be in response asap.

 

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View