Min.Order / FOB Price:Get Latest Price
1 Kilogram |
FOB Price: USD 1.0000 |
Exendin-4 141758-74-9 Exendin-4
Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceutical, chemical, food, health care, cosmetics and other fields. Customers are now in Asia, Europe, America and other countries and regions.
Company adheres to market-oriented, technology as the core, customer-centric. R & D headquarters is located in Suzhou, and the core members of R & D team consist of senior postdoctoral fellows and docteral students and masters who are rich in experience. The two factories, respectively located in Shandong and Henan, provide customers with complete services ranging from laboratory tests to pilot scale amplification and industrial production.
Our company is committed to the sustainable development and long-term success, to steadily enhance the value of the enterprise, to stick to the "integrity and win-win" spirit of enterprise, to establish a good corporate image, to provide high-quality, high value products for new and old customers at home and abroad wholeheartedly.
At present, our products focus on inorganic raw materials, most of which are lithium salts. We look forward to working with you sincerely and jointly create a promising future!
Product Name: | Exendin-4 |
Synonyms: | H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide (Exendin-4);Exenatide free base;XENDIN-4;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 |
CAS: | 141758-74-9 |
MF: | C184H282N50O60S |
MW: | 4186.57188 |
EINECS: | 686-356-3 |
Product Categories: | Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors |
Mol File: | 141758-74-9.mol |
CAS NO:57028-96-3
CAS NO:16251-45-9
CAS NO:7784-13-6
CAS NO:619-41-0
CAS NO:110-63-4
CAS NO:121-54-0
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View