lower price High quality Glucagon

Min.Order / FOB Price:Get Latest Price

1 Kilogram	FOB Price: USD 1.0000

1 Kilogram

FOB Price: USD 1.0000

Min.Order :1 Kilogram
Purity: 99%min
Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

Glucagon 16941-32-5 Glucagon

Quick Details

Appearance:white or almost white powder
Application: For scientific research
PackAge:1kg/drum, 25kg/drum, 200kg/drum,500kg/drum
ProductionCapacity:100|Metric Ton|Month
Storage:Keep it in dry, cool and ventilated place
Transportation:by sea or by air

Superiority:

Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceutical, chemical, food, health care, cosmetics and other fields. Customers are now in Asia, Europe, America and other countries and regions.

Company adheres to market-oriented, technology as the core, customer-centric. R & D headquarters is located in Suzhou, and the core members of R & D team consist of senior postdoctoral fellows and docteral students and masters who are rich in experience. The two factories, respectively located in Shandong and Henan, provide customers with complete services ranging from laboratory tests to pilot scale amplification and industrial production.

Our company is committed to the sustainable development and long-term success, to steadily enhance the value of the enterprise, to stick to the "integrity and win-win" spirit of enterprise, to establish a good corporate image, to provide high-quality, high value products for new and old customers at home and abroad wholeheartedly.

At present, our products focus on inorganic raw materials, most of which are lithium salts. We look forward to working with you sincerely and jointly create a promising future!

Details:

Product Name:	Glucagon
Synonyms:	GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
CAS:	16941-32-5
MF:	C153H225N43O49S
MW:	3482.75
EINECS:	685-611-6
Product Categories:	Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5
Mol File:	16941-32-5.mol