Teriparatide acetat...

Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Min.Order / FOB Price:Get Latest Price

1 Kilogram

FOB Price:USD 20.0000 -30.0000

  • Min.Order :1 Kilogram
  • Purity: 99%
  • Payment Terms : T/T

Keywords

Teriparatide acetate 52232-67-4 CAS 52232-67-4

Quick Details

  • Appearance:white powder
  • Application:industrial use
  • PackAge:1g,10g,100g
  • ProductionCapacity:50000|Kilogram|Month
  • Storage:cool and dry place
  • Transportation:by sea or by air

Superiority:

Company information:

Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries, most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific and technological enterprise world.

Quality:

Our products have good quality and we have many old customers.

Manufacturer technologly:

Our technology person is professinal with the chemical products,which is qualified with many standrad.

Price:

Our price is lowest and compective,if you have any needs,please don't hesitate to contact me.

Our service:

1.we are online 24 hours,can reply your message immediately.

2.we have good price and many kind of chemicals,can meet your needs.

3.we have goods in stock,can send out goods asap after you make the payment.is 

4.our payment term is varoius,you can choose what you want.

 

Details:

Teriparatide acetate CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS: 640-978-1
Product Categories: Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4
Mol File: 52232-67-4.mol

Company name:Hebei Mojin Biotechnology Co.,Ltd.

Established time:2017

Main field: chemical

Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in  chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries,

most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase

the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific

and technological enterprise world.

Product usage:

Industrial use

Picture of our company.

 

Product picture

Packing

25KG drum

Immediately shipping after you confirm the order.Prom

Shipping method:by sea or by air or by express

Advantage

1.we are online 24 hours,can reply your message immediately.

2.we have good price and many kind of chemicals,can meet your needs.

3.we have goods in stock,can send out goods asap after you make the payment.is 

4.our payment term is varoius,you can choose what you want.

Supply ability:

5000kg/week

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View