Teriparatide acetat...

Teriparatide acetate  CAS 52232-67-4
Teriparatide acetate  CAS 52232-67-4
Teriparatide acetate  CAS 52232-67-4
Teriparatide acetate  CAS 52232-67-4
Teriparatide acetate  CAS 52232-67-4

Teriparatide acetate CAS 52232-67-4

Min.Order / FOB Price:Get Latest Price

10 Gram

FOB Price: USD 10.0000

  • Min.Order :10 Gram
  • Purity: 99%
  • Payment Terms : L/C,T/T,Other

Keywords

Teriparatide acetate 52232-67-4 Teriparatide acetate Manufacturer

Quick Details

  • Appearance:White Liquid
  • Application:pharmaceutical or lose weight etc.
  • PackAge:25kg/ bag or drum
  • ProductionCapacity:10000 |Kilogram|Week
  • Storage:Cool and Dry Place
  • Transportation:By sea or air

Superiority:

Product quality:

Our company have high quality product , and also  the product we have good manufacture .

This product is of fine quality. Every finish should be checked by quality inspection system. 

We can ensure the product quality , If the product is not satisfactory, you can return it at any time.

Manufacturing technique

In the chemical industry, the process of producing a chemical product. Including raw material pretreatment, reactant chemical reaction and chemical product separation purification, final packaging sales.

Price

Our product have resonable price and good service high quality and inexpensive, you deserve.every webiste we have the sales point, your purchase is convenient.

Our service

1.we are online 24 hours,can reply your message immediately.

2.we have good price and many kind of chemicals,can meet your needs.

3.we have goods in stock,can send out goods asap after you make the payment.is 

4.our payment term is varoius,you can choose what you want.

Details:

Product Information

Teriparatide acetate Basic information
Application in Particular Diseases
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS: 640-978-1
Product Categories: Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4
Mol File: 52232-67-4.mol
Teriparatide acetate Structure
 
Teriparatide acetate Chemical Properties
Melting point  >205oC (dec.)
RTECS  SQ7770000
storage temp.  −20°C
solubility  DMSO (Slightly), Water (Slightly)
form  powder
color  White to Off-White
biological source human
Water Solubility  Soluble to 0.40 mg/ml in water
Sequence H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability: Hygroscopic
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)
Description The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Uses A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

Product Picture

Packing& shipping& Payment

Packing:5mg/10mg/15mg/20mg/30mg/60mg bottle,etc
Shipping:by sea or by air
Payment:T/T,,moneygram,bitcoin

Small quantity Bottle
Bulk quantity Box
Others Can do your package or split small packages according to your request
 

5MG/10MG/15MG/20MG/30MG/60MG Bottle.

 

Shipping:

By Courier: Fedex, EMS, DHL, TNT, UPS, etc. 7-10 days product will reach you after payment received,  if it's agreed as ready stock before order.

By air, airport to airport

By sea

 

Company Information

Hebei Mojin Biotechnology Co., Ltd, our business covers more than 30 countries, most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific and technological enterprise world.

 

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View