Min.Order / FOB Price:Get Latest Price
1 Gram |
FOB Price:USD 2.0000 -10.0000 |
1: PN:US6297214 SEQID: 1 claimed protein 1: PN: WO2004035624 FIGURE: 1 claimedprotein HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Our Advantage
Rich Experience
Our products are sold all over Europe,North&South America, Sino-East, Asia and pacific area as well as Africa,we establish long term.
Quality service
Company cooperates with research institutes. We strictly control the process of raw materials up to finished product.
24 hour service
Quick and clear response to customers questions. Warm after sale service, we will help to solve the problems in your usage.
High quality
Dedicated to serving customers first, we provide reasonable prices, high quality products.
Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,
Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.
Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization, Keep moving!
Our advantages:
1, High quality with competitive price:
1) Standard:BP/USP/EP/Enterprise standard
2) All Purity≥99%
3) We are manufacturer and can provide high quality products with factory price.
2, Fast and safe delivery
1) Parcel can be sent out in 24 hours after payment.Tracking number available
2) Secure and discreet shipment.Various transportation methods for your choice.
3) Customs pass rate ≥99%
4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,
and we have stock in there for transferring.
Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.
Packing:
1. Inner double plastic bags----25kg/Fiber drum (35*35*45cm, GW: 28kg, NW: 25kg);
2. Inner double plastic bags----5kg/Aluminum foil bag (GW: 6.5kg, NW: 5kg).
3. Inner double plastic bags----1kg/Aluminum foil bag (GW: 1.5kg, NW: 1kg).
P.S.: we accept packaging customization.
Delivery:
1. Stock products are normally shipping within 3 working days.
2. For rush delivery, please contact our sales team for particular arrangement.
Shipping Details:
1. We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 10g to 1000kg or even bulker.
2. Shipping details & shipping documents will be provided and sent by email.
3. We keep tracking the shippment until clients well received.
4. After years export shipping experience, with professional and experienced cooperated forwarders, we ensure that goods can be delivered in multiple ways safetly and efficiently.
FAQ:
1. Are you a trade company or factory
We are a factory with our own trading company.
2.How do you control the quality
Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.
3. How long is lead time
We deliver goods within 3 days for small order, 7-10 days for bulk order.
4. Where is your factory located How can I visit the factory
Our factory located in HEBEI, China.
5. Can i get some samples
Yes, we can supply free sample, but the shipping cost be paid by our customers.
6. How to start orders or make payments
Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,
7. How to confirm the Product Quality before placing orders
You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
8. How long is lead time
We deliver goods within 3 days for small order, 7-10 days for bulk order.
9. How do you treat quality complaint
First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View