CJC1295 6

CJC1295  6
CJC1295  6
CJC1295  6
CJC1295  6
CJC1295  6

CJC1295 6

Min.Order / FOB Price:Get Latest Price

1 box

FOB Price:USD 90.0000 -170.0000

  • Min.Order :1 box
  • Purity: 99%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

CJC-1295 CJC-1295 ipamorelin cjc 1295 cjc peptide

Quick Details

  • Appearance:Lyophilized powder
  • Application:Lose weight
  • PackAge:10 vials per box
  • ProductionCapacity:1000|box|Week
  • Storage:Double customs clearance. Cold chain transport
  • Transportation:Cold chain transport

Superiority:

 

Details:

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
CAS: 863288-34-0
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Product Categories: Peptides;CJC;863288-34-0
Mol File: 863288-34-0.mol
CJC1295 Structure

Key Specifications/ Special Features:

 


910463-68-2 lyophilized in Vials lose weight

Products details


picture

 

Why Choose Us

  • High quality products: We have rich experience in production and processing, strict quality inspection.
  • Reasonable prices: Factory direct, reasonable price and negotiable.
  • Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
  • Quick response: We will reply to your message within 24 hours.
  • Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

 

Shipping and Payment

 

Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View