CJC1295 19

Min.Order / FOB Price:Get Latest Price

1 box	FOB Price:USD 90.0000 -170.0000

1 box

FOB Price:USD 90.0000 -170.0000

CJC 1295 863288-34-0 cjc 1295 ipamorelin peptide ipamorelin cjc 1295 benefits

Product Name:	CJC1295
Synonyms:	CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
CAS:	863288-34-0
MF:	C152H252N44O42
MW:	3367.89688
EINECS:	206-141-6
Product Categories:	Peptides;CJC;863288-34-0
Mol File:	863288-34-0.mol
CJC1295 Structure

Key Specifications/ Special Features:

910463-68-2 lyophilized in Vials lose weight

picture

High quality products: We have rich experience in production and processing, strict quality inspection.
Reasonable prices: Factory direct, reasonable price and negotiable.
Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
Quick response: We will reply to your message within 24 hours.
Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

Shipping and Payment

Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods