ll 37 peptide ll37 peptide buy ll 37 peptide for sale
Product Name: | LL-37 |
Synonyms: | Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
CAS: | 154947-66-7 |
MF: |
C205H340N60O53 |
EINECS: | 211-519-9 |
Key Specifications/ Special Features:
154947-66-7 lyophilized in Vials lose weight
picture
Shipping and Payment
Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View