- Min.Order :1 box
- Purity: 99%
- Payment Terms : L/C,D/A,D/P,T/T,Other
Keywords
LL-37 factory ll 37 antibody antimicrobial peptide ll 37
Quick Details
- Appearance:Lyophilized powder
- Application:Lose weight
- PackAge:10 vials per box
- ProductionCapacity:1000|box|Week
- Storage:Double customs clearance. Cold chain transport
- Transportation:Cold chain transport
Superiority:
Details:
| Product Name: | LL-37 |
| Synonyms: | Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
| CAS: | 154947-66-7 |
| MF: |
C205H340N60O53 |
| EINECS: | 211-519-9 |
Key Specifications/ Special Features:
154947-66-7 lyophilized in Vials lose weight
Products details
picture
Why Choose Us
- High quality products: We have rich experience in production and processing, strict quality inspection.
- Reasonable prices: Factory direct, reasonable price and negotiable.
- Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
- Quick response: We will reply to your message within 24 hours.
- Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.
Shipping and Payment
Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods
You Might Also Like
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View