LL-37 10

LL-37  10
LL-37  10
LL-37  10
LL-37  10
LL-37  10
LL-37  10
LL-37  10

LL-37 10

Min.Order / FOB Price:Get Latest Price

1 box

FOB Price: USD 80.0000

  • Min.Order :1 box
  • Purity: 99%
  • Payment Terms : L/C,D/A,D/P,T/T,Other

Keywords

ll37 LL-37 human C205H340N60O53

Quick Details

  • Appearance:Lyophilized powder
  • Application:Lose weight
  • PackAge:10 vials per box
  • ProductionCapacity:1000|box|Week
  • Storage:Double customs clearance. Cold chain transport
  • Transportation:Cold chain transport

Superiority:

 

Details:

Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS: 154947-66-7
MF:

C205H340N60O53

EINECS: 211-519-9

Key Specifications/ Special Features:


154947-66-7 lyophilized in Vials lose weight

Products details


picture

 

Why Choose Us

  • High quality products: We have rich experience in production and processing, strict quality inspection.
  • Reasonable prices: Factory direct, reasonable price and negotiable.
  • Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
  • Quick response: We will reply to your message within 24 hours.
  • Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

 

Shipping and Payment

 

Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View