CJC1295 8...

CJC1295           863288-34-0
CJC1295           863288-34-0
CJC1295           863288-34-0
CJC1295           863288-34-0
CJC1295           863288-34-0

CJC1295 863288-34-0

Min.Order / FOB Price:Get Latest Price

1 Kilogram

FOB Price:USD 15.0000 -50.0000

  • Min.Order :1 Kilogram
  • Purity: >99%
  • Payment Terms : L/C,D/A,D/P,T/T

Keywords

CJC-1295 Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl

Quick Details

  • Appearance:Solid
  • Application:It is used in the production of medicines and spices, and can also be used as spices in itself. It is the standard material for gas chromatographic analysis
  • PackAge:5mg/vial, 10 vials per box
  • ProductionCapacity:3000|Kilogram|Month
  • Storage:-20°C Freezer, Under inert atmosphere
  • Transportation:EMS,DHL,?TNT,?UPS?,FEDEX,?BY?AIR,?BY?SEADHL?Express,?FedEx?and?EMS?for?quantity?less?than?50KG,?usually?called?as?DDU?service;?Sea?shipping?for?quantity?over?500KG;?And?air?shipping?is?available

Superiority:

Our Advantage 

Rich Experience 
Our products are sold all over Europe,North&South America, Sino-East, Asia and pacific area as well as Africa,we establish long term. 

Quality service 
Company cooperates with research institutes. We strictly control the process of raw materials up to finished product. 
  
24 hour service 
Quick and clear response to customers questions. Warm after sale service, we will help to solve the problems in your usage. 

High quality 
Dedicated to serving customers first, we provide reasonable prices, high quality products. 

Details:

Molecular Formula C152H252N44O42
Molar Mass 3367.89688
Density 1.45
Melting Point > 177° C (dec.)
Solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
Appearance Solid
Color White to Off-White
Storage Condition -20°C Freezer, Under inert atmosphere
Physical and Chemical Properties Appearance: white powder
Use Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2

 

Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,  

Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.  

Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization,  Keep moving!  

Superiority
As a reliable partner for Chinese market, we are specialized in chemical raw materials; consolidate sourcing, marketing, sales, distribution and after-sale services, providing our partners with sourcing evaluation, technology supports, toll/contract manufacture, investment solution and suitable partnership establishment in China.
Service we can provide:
1. provide costomers with "one-stop"packaging service,from manufacture ,research,development,production,export and so on
2. Quality control, before shipment.
3. Prompt shipment with professional documents
4. Packing as your request, with photo before shipment
5.Mix and different products in ONE PCL,increase the working efficiency for customers.
6.We can export from many China main ports,convenient for the customes provide logistics services.
Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.


Product Packaging

1) 1kg/bag (1kg net weight, 1.1kg gross weight, packed in an aluminum foil bag)

2) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two plastic-bags inside; Drum Size: 510mm high, 360mm diameter)

 Storage

Stored in a cool and dry well-closed container. Keep away from moisture and strong light/heat.

Delivery

Usually within3-5 working days after full payment.

transport

EMS,DHL, TNT, UPS ,FEDEX, BY AIR, BY SEA

DHL Express, FedEx and EMS for quantity less than 50KG, usually called as DDU service; 

Sea shipping for quantity over 500KG; And air shipping is available for 50KG above;

For high value products, please select air shipping and DHL express for safe;

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.

FAQ: 
1.Are you a trade company or factory   
We are a  factory with our own trading company.  

2.How do you control the quality   
Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.   

3.How long is lead time  
We deliver goods within 3 days for small order, 7-10 days for bulk order.   

4. Where is your factory located How can I visit the factory   
 Our factory located in HEBEI, China.

5.Can i get some samples 
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 

6.How to start orders or make payments 
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  

7. How to confirm the Product Quality before placing orders 
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
8. How long is lead time

We deliver goods within 3 days for small order, 7-10 days for bulk order.

9.How do you treat quality complaint

First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View